(data stored in ACNUC16935 zone)

EMBL: BN001307.PE323

BN001307.PE323       Location/Qualifiers
FT   CDS             join(883988..884063,884159..884169,884204..885037)
FT                   /locus_tag="ANIA_01486"
FT                   /old_locus_tag="AN1486.4"
FT                   /product="ribonuclease P complex subunit Pop2, putative
FT                   (AFU_orthologue; AFUA_8G04820)"
FT                   /note="transcript_id=CADANIAT00008108"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008108"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008108"
FT                   /db_xref="GOA:Q5BD94"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD94"
FT                   /protein_id="CBF84964.1"
FT                   /translation="MYYDLNVPYSPGDPEISATLSFLAEPNLTTINGKLPPNPTPPPLP
FT                   SDAPKDLTLLTRLNIPLSDPAQNQRLTSIAQAYDLVAVRPTNEKALLNACTNAECDIIS
FT                   LDLSIRHPYHFKFKMLSAAIARGIRFEICYGPGVTGSGLEARRNLIGNAMALIRAARGR
FT                   GIIVSSEAKRALGVRAPFDVINLACVWGLSQELGKEAISAETRKVTALARLKRTSWRGI
FT                   IDVVDGGQIPPASEAAASVAIVKDTGAKLNADNNGDNLKRKASTGPEPDADGPEKPLSK
FT                   REMKRRAKKARLEAALAGTDDSPAT"
     MYYDLNVPYS PGDPEISATL SFLAEPNLTT INGKLPPNPT PPPLPSDAPK DLTLLTRLNI        60
     PLSDPAQNQR LTSIAQAYDL VAVRPTNEKA LLNACTNAEC DIISLDLSIR HPYHFKFKML       120
     SAAIARGIRF EICYGPGVTG SGLEARRNLI GNAMALIRAA RGRGIIVSSE AKRALGVRAP       180
     FDVINLACVW GLSQELGKEA ISAETRKVTA LARLKRTSWR GIIDVVDGGQ IPPASEAAAS       240
     VAIVKDTGAK LNADNNGDNL KRKASTGPEP DADGPEKPLS KREMKRRAKK ARLEAALAGT       300
     DDSPAT                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page