(data stored in ACNUC16935 zone)

EMBL: BN001307.PE324

BN001307.PE324       Location/Qualifiers
FT   CDS             complement(join(886147..886651,886712..888246))
FT                   /locus_tag="ANIA_10201"
FT                   /old_locus_tag="AN10201.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008109"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008109"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008109"
FT                   /db_xref="GOA:C8VMG3"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG3"
FT                   /protein_id="CBF84965.1"
FT                   /translation="MTSTAPTNQQHPPSGPSSEFSGNQPPASSGADQSTHISTSGYAPS
FT                   ENQLAGLVEAATAAAGQDVSEWAAAAAVAAAAGAAGNQHHLDGYAPDIQLDEDGFDEGG
FT                   YAGMTGARHYRGPGSTSGNEHGQSSGLARSGTKKRKRNEDALDPALAAASASLGQHHGQ
FT                   PQHQNQSQHHVHHASPYPGEGLEIRNTPPQTLADARAVGLHSAAALFRQTSTNKKYTRP
FT                   PMSKMFTSLELSPENFLHLQAAAKAYMLDDRHPERRDCVGQRGKGDTEMVKLRLWNCVR
FT                   HFLEVEGNGPRFFGEHVVNEGMPPRTYVWPRDQQKIISLVIPLLRRMVTNERQRQYAVE
FT                   TRKGGVEARRRRKTEDSIQDFRSASPPKFSSEDHLQMQADHQLPDGYSSTQHPLSASAP
FT                   PPPHSEPSVQVTELGLTDLILDGYSTDLDSISKSYDSYNHNYELDNLWSLSGLHLGDWR
FT                   GLVAAVDSHYQILHEGDYNCSGCCEDGNIGRILNSTSTADLRWRIGGDPARNEFASSIT
FT                   RDVSRVIRDNLAARQGAQNHTSLPQTQPIPPPLPFSHSSDLSNPNPPPAQSPLRLRINI
FT                   LQNGKRILPSYDLPATQGPDVTTVRQLVARKFAGELPGIPSDLNSDSNTWNASISWKFK
FT                   VWLPEGLVLIENDGDWTLALLAAEKVDWLDGELKVLVEIEDENQ"
     MTSTAPTNQQ HPPSGPSSEF SGNQPPASSG ADQSTHISTS GYAPSENQLA GLVEAATAAA        60
     GQDVSEWAAA AAVAAAAGAA GNQHHLDGYA PDIQLDEDGF DEGGYAGMTG ARHYRGPGST       120
     SGNEHGQSSG LARSGTKKRK RNEDALDPAL AAASASLGQH HGQPQHQNQS QHHVHHASPY       180
     PGEGLEIRNT PPQTLADARA VGLHSAAALF RQTSTNKKYT RPPMSKMFTS LELSPENFLH       240
     LQAAAKAYML DDRHPERRDC VGQRGKGDTE MVKLRLWNCV RHFLEVEGNG PRFFGEHVVN       300
     EGMPPRTYVW PRDQQKIISL VIPLLRRMVT NERQRQYAVE TRKGGVEARR RRKTEDSIQD       360
     FRSASPPKFS SEDHLQMQAD HQLPDGYSST QHPLSASAPP PPHSEPSVQV TELGLTDLIL       420
     DGYSTDLDSI SKSYDSYNHN YELDNLWSLS GLHLGDWRGL VAAVDSHYQI LHEGDYNCSG       480
     CCEDGNIGRI LNSTSTADLR WRIGGDPARN EFASSITRDV SRVIRDNLAA RQGAQNHTSL       540
     PQTQPIPPPL PFSHSSDLSN PNPPPAQSPL RLRINILQNG KRILPSYDLP ATQGPDVTTV       600
     RQLVARKFAG ELPGIPSDLN SDSNTWNASI SWKFKVWLPE GLVLIENDGD WTLALLAAEK       660
     VDWLDGELKV LVEIEDENQ                                                    679
//

If you have problems or comments...

PBIL Back to PBIL home page