(data stored in ACNUC16935 zone)

EMBL: BN001307.PE325

BN001307.PE325       Location/Qualifiers
FT   CDS             complement(888915..890129)
FT                   /locus_tag="ANIA_10196"
FT                   /old_locus_tag="AN10196.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008110"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008110"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008110"
FT                   /db_xref="GOA:C8VMG4"
FT                   /db_xref="InterPro:IPR021838"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMG4"
FT                   /protein_id="CBF84967.1"
FT                   /translation="MATTRRFVPLLGCGFFFFCLWGLFSLSRSWTQMKVSQAVGLGELV
FT                   STPSPTPSGYWNVTEGPKQPFAPRPQYVAGIARPDGHEYTKTLVIPRTTYEDTSWTEFE
FT                   IPGWETAVYVVDDPSAPLHPPKNKGHEVMVYLSYIIEHYDELPEIIAFMHSHQFGWHND
FT                   DLLDGNAATILQRLRPERVIREGYMNLRCGWGPGCPDWLHPGTLEEDESKQEEILLARS
FT                   WGEIFPDDPIPDVLAQPCCAQFAVSRERVHAIPRARFVFYRDWVLRTELSDYISGRIWE
FT                   YLWHVIFTGQNVVCPKEHVCFCDGYGICFGGEDEYNAYRNMDSEREAWEDELKRWRSRA
FT                   AVIESARRRGTLGEKSHLSVPEPGRDIELEELIARHGELKEELLLNATIRGQDAKARAL
FT                   EVGIW"
     MATTRRFVPL LGCGFFFFCL WGLFSLSRSW TQMKVSQAVG LGELVSTPSP TPSGYWNVTE        60
     GPKQPFAPRP QYVAGIARPD GHEYTKTLVI PRTTYEDTSW TEFEIPGWET AVYVVDDPSA       120
     PLHPPKNKGH EVMVYLSYII EHYDELPEII AFMHSHQFGW HNDDLLDGNA ATILQRLRPE       180
     RVIREGYMNL RCGWGPGCPD WLHPGTLEED ESKQEEILLA RSWGEIFPDD PIPDVLAQPC       240
     CAQFAVSRER VHAIPRARFV FYRDWVLRTE LSDYISGRIW EYLWHVIFTG QNVVCPKEHV       300
     CFCDGYGICF GGEDEYNAYR NMDSEREAWE DELKRWRSRA AVIESARRRG TLGEKSHLSV       360
     PEPGRDIELE ELIARHGELK EELLLNATIR GQDAKARALE VGIW                        404
//

If you have problems or comments...

PBIL Back to PBIL home page