(data stored in ACNUC16935 zone)

EMBL: BN001307.PE326

BN001307.PE326       Location/Qualifiers
FT   CDS             complement(join(891217..893415,893477..893581,
FT                   893638..893661))
FT                   /locus_tag="ANIA_01488"
FT                   /old_locus_tag="AN1488.4"
FT                   /product="RING finger protein (AFU_orthologue;
FT                   AFUA_8G04840)"
FT                   /note="transcript_id=CADANIAT00008111"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008111"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008111"
FT                   /db_xref="GOA:Q5BD92"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR024766"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD92"
FT                   /protein_id="CBF84968.1"
FT                   /translation="MRFAAYAGASVALATGVFLKALHQRANFYSACVYLSQSSANLMIL
FT                   TNVCLLAVGFLLFWLQRLLYGPLRPIETEQLYEKAWFAVTETCLAMTIFRGELGAWFLV
FT                   MFVSLLVGKVWGWIGEGRVEFLEQQPPANPLLFHTRLVVSLLLSVMFDIFMLKYCIDTV
FT                   LEQARPDMMVMFGFEFAVLTILSTSTAARYSISLVEIYINRQQMKARIEERRQEIRAAR
FT                   EQALAEHAATEDQTANLDLPDENDINELELDIPGWEEKGRWVFYLDLLTDFLKLTVYLT
FT                   FFAILFTFYGLPIHILRDVVVTIRSFGRRIMDFARYRNATRDMNDRYPDASAEEVAREE
FT                   VCIICREEMTHWQPGDRPVSRVSERLRPKKLPCGHILHFSCLRSWLERQQNCPTCRRPV
FT                   IAPPRNQGPAGVNMGQGNGGAGQQQNMPPGNQPVNQNPPADGLPRARIYQFGPFRIGFG
FT                   AGRGDLFNNLHQQIHQGNGPWQPGMNPNPAGARQIGFGFGFGRPPLQQAPAPAAPAATQ
FT                   PVPTPTSNLPNLQNQLLQMEQQIANEINGLRIAADQLNLVRLLQTELQRLRTLQSQPLN
FT                   NQTNIPQNPSPSIPSISPTTTRPRIVSNPETAPMGAGDPRLPDGLTLPQGWTLVPLHSV
FT                   QPGLSASSNVAANASSSEAEHSAPPSEGMLNSQVPTDTESQRPSDRSDAATSGSSGLPN
FT                   WQSSPFSHSAADSTGAISQQSENLSSEAGLRAPLAPSKTEQVETPLSEHGAETRIETQT
FT                   SDSRSKGKERVATVEDAADDET"
     MRFAAYAGAS VALATGVFLK ALHQRANFYS ACVYLSQSSA NLMILTNVCL LAVGFLLFWL        60
     QRLLYGPLRP IETEQLYEKA WFAVTETCLA MTIFRGELGA WFLVMFVSLL VGKVWGWIGE       120
     GRVEFLEQQP PANPLLFHTR LVVSLLLSVM FDIFMLKYCI DTVLEQARPD MMVMFGFEFA       180
     VLTILSTSTA ARYSISLVEI YINRQQMKAR IEERRQEIRA AREQALAEHA ATEDQTANLD       240
     LPDENDINEL ELDIPGWEEK GRWVFYLDLL TDFLKLTVYL TFFAILFTFY GLPIHILRDV       300
     VVTIRSFGRR IMDFARYRNA TRDMNDRYPD ASAEEVAREE VCIICREEMT HWQPGDRPVS       360
     RVSERLRPKK LPCGHILHFS CLRSWLERQQ NCPTCRRPVI APPRNQGPAG VNMGQGNGGA       420
     GQQQNMPPGN QPVNQNPPAD GLPRARIYQF GPFRIGFGAG RGDLFNNLHQ QIHQGNGPWQ       480
     PGMNPNPAGA RQIGFGFGFG RPPLQQAPAP AAPAATQPVP TPTSNLPNLQ NQLLQMEQQI       540
     ANEINGLRIA ADQLNLVRLL QTELQRLRTL QSQPLNNQTN IPQNPSPSIP SISPTTTRPR       600
     IVSNPETAPM GAGDPRLPDG LTLPQGWTLV PLHSVQPGLS ASSNVAANAS SSEAEHSAPP       660
     SEGMLNSQVP TDTESQRPSD RSDAATSGSS GLPNWQSSPF SHSAADSTGA ISQQSENLSS       720
     EAGLRAPLAP SKTEQVETPL SEHGAETRIE TQTSDSRSKG KERVATVEDA ADDET            775
//

If you have problems or comments...

PBIL Back to PBIL home page