(data stored in ACNUC16935 zone)

EMBL: BN001307.PE329

BN001307.PE329       Location/Qualifiers
FT   CDS             complement(join(900232..901260,901313..901593,
FT                   901653..901697,901746..901887))
FT                   /locus_tag="ANIA_01491"
FT                   /old_locus_tag="AN1491.4"
FT                   /product="COP9 signalosome complex subunit 1 (CSN complex
FT                   subunit 1) [Source:UniProtKB/Swiss-Prot;Acc:Q5BD89]"
FT                   /note="transcript_id=CADANIAT00008114"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008114"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008114"
FT                   /db_xref="GOA:Q5BD89"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR019585"
FT                   /db_xref="InterPro:IPR033008"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD89"
FT                   /protein_id="CBF84973.1"
FT                   /translation="MEPMLPEAGEAALLSSYAPQASGSMGVDPDPITGLVSTSAAPLVR
FT                   VEEAPKFELESYIANYTGRTRFNRLYLIGTCSSYLAVDALKAAIAEAKSGKDVARYLRA
FT                   VQALADVAPNEPEATIDSDWVERSQKVVKAETDRLEHELRGYKNNLIKESIRMGNEELG
FT                   QHYHRIGDLTSAFKAYSRMRDFCTTPSHIASMLFKIINVAIERGDWLNVQSNVHRLRSQ
FT                   GGKPEEQAKHQPKISAAMGLSQLHSGSYLEAANSFIATDPSLGDTFNEVLTSNDVAVYG
FT                   GLCALASMDRNELQRRVLDNSSFRNFLELEPHIRRAISFFCNSKFRPCLEILEAYRADY
FT                   LLDIHLQRHVQVLYNRIRTKSIQQYLIPFNRVSLESMAKIFVLGNPTSQSSQSDSKSAF
FT                   VQELISLIQDGTLDARIDLEKHVLVSTQGDKRIEVQEAVLDSLDNYVREAHLRLLRSNI
FT                   IRAGLEVRPLGEDRRTKLEERGKKGHSAIGNLLRATGMKQ"
     MEPMLPEAGE AALLSSYAPQ ASGSMGVDPD PITGLVSTSA APLVRVEEAP KFELESYIAN        60
     YTGRTRFNRL YLIGTCSSYL AVDALKAAIA EAKSGKDVAR YLRAVQALAD VAPNEPEATI       120
     DSDWVERSQK VVKAETDRLE HELRGYKNNL IKESIRMGNE ELGQHYHRIG DLTSAFKAYS       180
     RMRDFCTTPS HIASMLFKII NVAIERGDWL NVQSNVHRLR SQGGKPEEQA KHQPKISAAM       240
     GLSQLHSGSY LEAANSFIAT DPSLGDTFNE VLTSNDVAVY GGLCALASMD RNELQRRVLD       300
     NSSFRNFLEL EPHIRRAISF FCNSKFRPCL EILEAYRADY LLDIHLQRHV QVLYNRIRTK       360
     SIQQYLIPFN RVSLESMAKI FVLGNPTSQS SQSDSKSAFV QELISLIQDG TLDARIDLEK       420
     HVLVSTQGDK RIEVQEAVLD SLDNYVREAH LRLLRSNIIR AGLEVRPLGE DRRTKLEERG       480
     KKGHSAIGNL LRATGMKQ                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page