(data stored in ACNUC16935 zone)

EMBL: BN001307.PE330

BN001307.PE330       Location/Qualifiers
FT   CDS             join(904258..904903,905098..905258)
FT                   /locus_tag="ANIA_01492"
FT                   /old_locus_tag="AN1492.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008115"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008115"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008115"
FT                   /db_xref="GOA:Q5BD88"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD88"
FT                   /protein_id="CBF84974.1"
FT                   /translation="MPFATPIKTSAGITLPVDLKEASVETASMTTAIVAHTLRGMDCMS
FT                   YKISTGFAVGSNKKLDLASNKWWLLISFDTPKNAKPTWEEDIIRDLMNRLGLPVSEAIP
FT                   PSDRDSALLQAQNGEQSSRMARIRSKIRTMQQTSRLNSLKSRLDSLTLHHEKTVRVYDD
FT                   IPFLLSYGAHDADFAIYDELCRHLQAGGETRLCGFAFTLRELQTWDKIDERLDQFSPSF
FT                   CIVALNVAILAPYSDHSCSKADGGSRFLNPGKLSLHITSSIAMQNQ"
     MPFATPIKTS AGITLPVDLK EASVETASMT TAIVAHTLRG MDCMSYKIST GFAVGSNKKL        60
     DLASNKWWLL ISFDTPKNAK PTWEEDIIRD LMNRLGLPVS EAIPPSDRDS ALLQAQNGEQ       120
     SSRMARIRSK IRTMQQTSRL NSLKSRLDSL TLHHEKTVRV YDDIPFLLSY GAHDADFAIY       180
     DELCRHLQAG GETRLCGFAF TLRELQTWDK IDERLDQFSP SFCIVALNVA ILAPYSDHSC       240
     SKADGGSRFL NPGKLSLHIT SSIAMQNQ                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page