(data stored in ACNUC16935 zone)

EMBL: BN001307.PE331

BN001307.PE331       Location/Qualifiers
FT   CDS             complement(join(905426..905815,905911..906005,
FT                   906064..906175))
FT                   /locus_tag="ANIA_01493"
FT                   /old_locus_tag="AN1493.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008116"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008116"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008116"
FT                   /db_xref="GOA:Q5BD87"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD87"
FT                   /protein_id="CBF84976.1"
FT                   /translation="MVLFRSVLAFASVAGLAISQDASTTTVDIQSLDDGTKKQWCIAQT
FT                   SSCPLLCLQLPGASGDPTSNTCDDDTLAYNCVCDNGQSPNASEYSQTIPYFLCTEENNN
FT                   CVAACSQGDSSCQDSCRTSNPCGAQNPKLVNTTSTNGSSTATSTTTSTTSSLAPFTGLP
FT                   DDDEGAAVRPVTDLRQVYGLFAVLGGFFAGFTILL"
     MVLFRSVLAF ASVAGLAISQ DASTTTVDIQ SLDDGTKKQW CIAQTSSCPL LCLQLPGASG        60
     DPTSNTCDDD TLAYNCVCDN GQSPNASEYS QTIPYFLCTE ENNNCVAACS QGDSSCQDSC       120
     RTSNPCGAQN PKLVNTTSTN GSSTATSTTT STTSSLAPFT GLPDDDEGAA VRPVTDLRQV       180
     YGLFAVLGGF FAGFTILL                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page