(data stored in ACNUC16935 zone)

EMBL: BN001307.PE332

BN001307.PE332       Location/Qualifiers
FT   CDS             join(907137..907199,907915..908412,908499..908551,
FT                   908637..908673,908736..908780)
FT                   /locus_tag="ANIA_09515"
FT                   /old_locus_tag="AN9515.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008117"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008117"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008117"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQB5"
FT                   /protein_id="CBF84978.1"
FT                   /translation="MSWKDADAGPCPSSQKRIRGLALPPPISGSEVSKWMAPANEETGR
FT                   VPRPQPLPASPHPSSGIPSAPDRDGDAVEPADSNPGEISANPSSASSSRSQLESPNLAP
FT                   KERPVSGIVPPYWSHHRNASRASQISADGGPAITLEDHTEDPNSETSRGLWAKSVTIDD
FT                   HVVVQGKSGVGAYVVWNCKIRTLEGGTITVRMRYSYGSAIISTPSQRYPRRVFYSSFGH
FT                   LSLNLAKLV"
     MSWKDADAGP CPSSQKRIRG LALPPPISGS EVSKWMAPAN EETGRVPRPQ PLPASPHPSS        60
     GIPSAPDRDG DAVEPADSNP GEISANPSSA SSSRSQLESP NLAPKERPVS GIVPPYWSHH       120
     RNASRASQIS ADGGPAITLE DHTEDPNSET SRGLWAKSVT IDDHVVVQGK SGVGAYVVWN       180
     CKIRTLEGGT ITVRMRYSYG SAIISTPSQR YPRRVFYSSF GHLSLNLAKL V                231
//

If you have problems or comments...

PBIL Back to PBIL home page