(data stored in ACNUC16935 zone)

EMBL: BN001307.PE333

BN001307.PE333       Location/Qualifiers
FT   CDS             join(913046..915361,915409..915777,915829..916620,
FT                   916685..917056)
FT                   /locus_tag="ANIA_01494"
FT                   /old_locus_tag="AN1494.4"
FT                   /product="transcription initiation factor TFIID subunit
FT                   TSM1/127kD, putative (AFU_orthologue; AFUA_8G04950)"
FT                   /note="transcript_id=CADANIAT00008118"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008118"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008118"
FT                   /db_xref="GOA:Q5BD86"
FT                   /db_xref="InterPro:IPR037813"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD86"
FT                   /protein_id="CBF84980.1"
FT                   /translation="MPGVVDTPAGPSWPGLGFTVAHQKVELELDFASRSLKGKTEIIIH
FT                   PHYKDLRYIRLNFRQGELKRVTVSGKVPLVKYTDPYESLQLYGPHYHQRLASKLDALLK
FT                   TPSEPELTLTLPKSVRIDELDPFSVEAQDQMALRAPGLADDTEGPLSSKTAETSLPRFT
FT                   ALTVTIEFIVENIRDGIQFVGVENGDKRYPHAYTTNSLDHGTGCPLFPCVDDPSSRCTW
FT                   EIAIRCPCTLGDVFERKPRDQSVSGTGTRLRSNHDRLAPDDEALDLSVVCSGELTDDIV
FT                   DSKDSSKKTVSFASYSPLSARQIGFAVGPFEYVNLADFRESDQDEQLGQNAIPLHAFCL
FT                   PGRGDEVRNTCFPMAKAIDFFSMTYGSYPFSSYKMCFVDDAPEDTLPTACFSICSSRLL
FT                   FPEEIIDPMYDSTRAITHALAAQWIGVNIVPKEPADTWVTVGVAWYITDTFMRKLCGNN
FT                   EYRFRLKLMSDRVCDLDYERPSVYDMGNILSIDPSEAKFIALKAPLVLFILDRRLTKAS
FT                   GKATMSRIISRLFLNARMGELPNGAVTSSVFQKTCERLGHAKLDTFFNQWIYGAGCPRF
FT                   QATQRFNKKKLVVEMMIKQVQSDQPTARDLERDAFMRDVKEEIRNVYAGTIQPVFTGSM
FT                   TIRIHEADGTPYEHIVEIKEGVTKFDIPYNTKYKRLKRNKRQKERAAAVIGADGNAEVQ
FT                   EDILLYCLGDVLQSEEEMQQWRLADWSKEDEERMGQESYEWIRMDADFEWICKLSLVMP
FT                   GYMYLSQLQQDRDVVAQLESLQYMAAQREHPLISTIFLRTLMDRRYFYGIRVAAARALV
FT                   KHAKEEINWLGLFHLEKAFQELFCLPGSPMTRSNNFSDRAAYVLQLVIPEAISKVRDVS
FT                   GKTPMRVKRFLYDKLKFNDNSNNEYSDNFYVATLMKSLCHAMLGRVESRTDDLNNFDMD
FT                   AVLEAQAEEQLEKDAIAEIDRYRRMDEWSSSFQNLYSRAALYCQMQLMQAKIAEVDVMQ
FT                   FLPYTRVGTYDLLRLDAFECLVELDIFKSPELLRWFIFTMSNDPSIWLRWQLHGLFGRA
FT                   LAPVAFGRGVINEPPPPTDGLIIEQESSTEVRQADLARRQTVTGALAALKAEVSGDQVL
FT                   KECLWAACSSPIIGILELSEFTDLCRVIYDPVTSKRVTLKYPRYWAVKHHGRGRLQFYR
FT                   TNKIRTSLNPSTTSSAKRKREDGTAMPAPSSGLRVTFKQSRPNPSNHHPSTPSAKTPGP
FT                   SSGLGTPLQQRQPTKLHIPNFAAAQVHRQPPSHTPATPSTPGGGLKLKLKLGSQPKQ"
     MPGVVDTPAG PSWPGLGFTV AHQKVELELD FASRSLKGKT EIIIHPHYKD LRYIRLNFRQ        60
     GELKRVTVSG KVPLVKYTDP YESLQLYGPH YHQRLASKLD ALLKTPSEPE LTLTLPKSVR       120
     IDELDPFSVE AQDQMALRAP GLADDTEGPL SSKTAETSLP RFTALTVTIE FIVENIRDGI       180
     QFVGVENGDK RYPHAYTTNS LDHGTGCPLF PCVDDPSSRC TWEIAIRCPC TLGDVFERKP       240
     RDQSVSGTGT RLRSNHDRLA PDDEALDLSV VCSGELTDDI VDSKDSSKKT VSFASYSPLS       300
     ARQIGFAVGP FEYVNLADFR ESDQDEQLGQ NAIPLHAFCL PGRGDEVRNT CFPMAKAIDF       360
     FSMTYGSYPF SSYKMCFVDD APEDTLPTAC FSICSSRLLF PEEIIDPMYD STRAITHALA       420
     AQWIGVNIVP KEPADTWVTV GVAWYITDTF MRKLCGNNEY RFRLKLMSDR VCDLDYERPS       480
     VYDMGNILSI DPSEAKFIAL KAPLVLFILD RRLTKASGKA TMSRIISRLF LNARMGELPN       540
     GAVTSSVFQK TCERLGHAKL DTFFNQWIYG AGCPRFQATQ RFNKKKLVVE MMIKQVQSDQ       600
     PTARDLERDA FMRDVKEEIR NVYAGTIQPV FTGSMTIRIH EADGTPYEHI VEIKEGVTKF       660
     DIPYNTKYKR LKRNKRQKER AAAVIGADGN AEVQEDILLY CLGDVLQSEE EMQQWRLADW       720
     SKEDEERMGQ ESYEWIRMDA DFEWICKLSL VMPGYMYLSQ LQQDRDVVAQ LESLQYMAAQ       780
     REHPLISTIF LRTLMDRRYF YGIRVAAARA LVKHAKEEIN WLGLFHLEKA FQELFCLPGS       840
     PMTRSNNFSD RAAYVLQLVI PEAISKVRDV SGKTPMRVKR FLYDKLKFND NSNNEYSDNF       900
     YVATLMKSLC HAMLGRVESR TDDLNNFDMD AVLEAQAEEQ LEKDAIAEID RYRRMDEWSS       960
     SFQNLYSRAA LYCQMQLMQA KIAEVDVMQF LPYTRVGTYD LLRLDAFECL VELDIFKSPE      1020
     LLRWFIFTMS NDPSIWLRWQ LHGLFGRALA PVAFGRGVIN EPPPPTDGLI IEQESSTEVR      1080
     QADLARRQTV TGALAALKAE VSGDQVLKEC LWAACSSPII GILELSEFTD LCRVIYDPVT      1140
     SKRVTLKYPR YWAVKHHGRG RLQFYRTNKI RTSLNPSTTS SAKRKREDGT AMPAPSSGLR      1200
     VTFKQSRPNP SNHHPSTPSA KTPGPSSGLG TPLQQRQPTK LHIPNFAAAQ VHRQPPSHTP      1260
     ATPSTPGGGL KLKLKLGSQP KQ                                               1282
//

If you have problems or comments...

PBIL Back to PBIL home page