(data stored in ACNUC16935 zone)

EMBL: BN001307.PE335

BN001307.PE335       Location/Qualifiers
FT   CDS             join(918517..918592,918664..919802)
FT                   /locus_tag="ANIA_10211"
FT                   /old_locus_tag="AN10211.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008120"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008120"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008120"
FT                   /db_xref="GOA:C8VMM6"
FT                   /db_xref="InterPro:IPR012890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM6"
FT                   /protein_id="CBF84984.1"
FT                   /translation="MSSGFANRRKPRKIGGDDGNDDEEQDTGPIIKRPVSLKVKQKSKA
FT                   RVSFGPGETSMTEGDDGESEVIVPKKHGLGRRVVEKNAFQKSTTPSALSNQLPLRVGPE
FT                   QDRPSYNEEYLNELRNLTASTPKPTADSENQNEVDVAAKFGEVTKVTAPSLIPTEAEIR
FT                   EKKARRARLAKEQDSHSLTEQDYISLEENAGDDWELVDREYDRDTRLVRDDEDFAEGFD
FT                   EYVEDGRISLGRKAEREQNRKQREAMRELIEDAEALMDEEDSDLEEKAAYEAAQTRAAM
FT                   GYGNGPVDRPKTPPKMTSLPRLSTCLDRLRMNLAVLEKSRTQMINRMEELRKEKANISV
FT                   REVEIQALIKETGDHYEKLKQEAGVTPGSEAETPGTTDFESSRGLENIGAPSTAVSKTN
FT                   SESET"
     MSSGFANRRK PRKIGGDDGN DDEEQDTGPI IKRPVSLKVK QKSKARVSFG PGETSMTEGD        60
     DGESEVIVPK KHGLGRRVVE KNAFQKSTTP SALSNQLPLR VGPEQDRPSY NEEYLNELRN       120
     LTASTPKPTA DSENQNEVDV AAKFGEVTKV TAPSLIPTEA EIREKKARRA RLAKEQDSHS       180
     LTEQDYISLE ENAGDDWELV DREYDRDTRL VRDDEDFAEG FDEYVEDGRI SLGRKAEREQ       240
     NRKQREAMRE LIEDAEALMD EEDSDLEEKA AYEAAQTRAA MGYGNGPVDR PKTPPKMTSL       300
     PRLSTCLDRL RMNLAVLEKS RTQMINRMEE LRKEKANISV REVEIQALIK ETGDHYEKLK       360
     QEAGVTPGSE AETPGTTDFE SSRGLENIGA PSTAVSKTNS ESET                        404
//

If you have problems or comments...

PBIL Back to PBIL home page