(data stored in ACNUC16935 zone)

EMBL: BN001307.PE336

BN001307.PE336       Location/Qualifiers
FT   CDS             join(920012..920088,920159..920319,920370..920722,
FT                   920780..921058,921123..921876,922684..922835)
FT                   /locus_tag="ANIA_10209"
FT                   /old_locus_tag="AN10209.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008121"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008121"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008121"
FT                   /db_xref="GOA:C8VMM7"
FT                   /db_xref="InterPro:IPR010640"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMM7"
FT                   /protein_id="CBF84986.1"
FT                   /translation="MSRTPFFSLGRWSLPRAERASIGPTQGLALIETPIDEKDGVPPHL
FT                   YRRSDATPIELFFDLFLVANLSTFTATHEINNVEALVTYIGFLGVIWFTWLQVMMFDIR
FT                   FARDSLFERICKAMQLGIMVGFASAGTRITTRVRPENVWAFQSLSLMLGGSRLLLSVQY
FT                   IVSTVLIRKRMSCASKGLYFIAAALLVSSLVHFGMYFVFGEDSAHSYVWTVWFVLFWVE
FT                   MWTVFATSCITPDIGFQDTPLNVRMGLLTLIIIGEGVISVTRLVNKTVRPGGWTRWSFV
FT                   HILGVTTNVYFIWQEYFDLTPTRTIGTFAQQIWAQLHFPFHVALVLLLEGSQILALTLD
FT                   ITLKLQYLTETILFACEEPRPDPELAVKLLCDTIADMEIEYSRGAISEQMAIHDILNDL
FT                   PNHEICPVNGTIGFTLTRNMFNDLVGNVTSALFSSMRIVPPQSAHVSTMDSSQLLRMYV
FT                   ELLGFVYVYYFLVASLAMLLFAAFGLLAQRHDKPLAMAIGVAVRIVSGIFLASLTIFAK
FT                   HFELAYSFMKSPTILYAFTFVLLGGTTEQNGSDGRLHAQRCATGLGLEAAKDTELELDR
FT                   AHALSALTWHAYRQL"
     MSRTPFFSLG RWSLPRAERA SIGPTQGLAL IETPIDEKDG VPPHLYRRSD ATPIELFFDL        60
     FLVANLSTFT ATHEINNVEA LVTYIGFLGV IWFTWLQVMM FDIRFARDSL FERICKAMQL       120
     GIMVGFASAG TRITTRVRPE NVWAFQSLSL MLGGSRLLLS VQYIVSTVLI RKRMSCASKG       180
     LYFIAAALLV SSLVHFGMYF VFGEDSAHSY VWTVWFVLFW VEMWTVFATS CITPDIGFQD       240
     TPLNVRMGLL TLIIIGEGVI SVTRLVNKTV RPGGWTRWSF VHILGVTTNV YFIWQEYFDL       300
     TPTRTIGTFA QQIWAQLHFP FHVALVLLLE GSQILALTLD ITLKLQYLTE TILFACEEPR       360
     PDPELAVKLL CDTIADMEIE YSRGAISEQM AIHDILNDLP NHEICPVNGT IGFTLTRNMF       420
     NDLVGNVTSA LFSSMRIVPP QSAHVSTMDS SQLLRMYVEL LGFVYVYYFL VASLAMLLFA       480
     AFGLLAQRHD KPLAMAIGVA VRIVSGIFLA SLTIFAKHFE LAYSFMKSPT ILYAFTFVLL       540
     GGTTEQNGSD GRLHAQRCAT GLGLEAAKDT ELELDRAHAL SALTWHAYRQ L                591
//

If you have problems or comments...

PBIL Back to PBIL home page