(data stored in ACNUC16935 zone)

EMBL: BN001307.PE337

BN001307.PE337       Location/Qualifiers
FT   CDS             join(925032..926315,926366..926522,926656..926675)
FT                   /locus_tag="ANIA_01497"
FT                   /old_locus_tag="AN1497.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008122"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008122"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008122"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD83"
FT                   /protein_id="CBF84987.1"
FT                   /translation="MTERNLLSSSCLAALPDSCAAAPAMSFDTSSTIGQRSESTMRCEQ
FT                   LQIGDHGETDGQYLATSAGVLNDDFSGRDFQTSGEQYRRWHANFSSTEPAKSVRPTSQN
FT                   SFHWKLQKIDRPSTKDTFTVEELNSNSGGAPTPDLVHPIPRHSPYAVTSYFTSEKIPET
FT                   STFGKTESPLSEDKKCLVRGSNWTSDDFAFSCLLQERQSPDASSLTTLPDNYTPVTTDG
FT                   TYTDHSVSPWPSVKTQLSWDTQTANATHCKEEVAWNEPRFFPDVEQQQTHFDQFPVTTD
FT                   NIHGFPSLGHSAETYVQPSSLLDPYGSTCPGLYLNGSTITQQEQSPIPYSSSTLVFQNG
FT                   LRPDESTDSFFPSGSISYQPSHVGHMATWTNDVKNALLIEYKRQGLSYKDIKRIAGFKE
FT                   AESTLRGRFRTLTKSKEQRVRKPQWHEKDVRLLCEAVNVYSEDGRISPYSRRPVPPTKI
FT                   PWKKVAQYIWNNGGSYHFGNSTYNMNSQ"
     MTERNLLSSS CLAALPDSCA AAPAMSFDTS STIGQRSEST MRCEQLQIGD HGETDGQYLA        60
     TSAGVLNDDF SGRDFQTSGE QYRRWHANFS STEPAKSVRP TSQNSFHWKL QKIDRPSTKD       120
     TFTVEELNSN SGGAPTPDLV HPIPRHSPYA VTSYFTSEKI PETSTFGKTE SPLSEDKKCL       180
     VRGSNWTSDD FAFSCLLQER QSPDASSLTT LPDNYTPVTT DGTYTDHSVS PWPSVKTQLS       240
     WDTQTANATH CKEEVAWNEP RFFPDVEQQQ THFDQFPVTT DNIHGFPSLG HSAETYVQPS       300
     SLLDPYGSTC PGLYLNGSTI TQQEQSPIPY SSSTLVFQNG LRPDESTDSF FPSGSISYQP       360
     SHVGHMATWT NDVKNALLIE YKRQGLSYKD IKRIAGFKEA ESTLRGRFRT LTKSKEQRVR       420
     KPQWHEKDVR LLCEAVNVYS EDGRISPYSR RPVPPTKIPW KKVAQYIWNN GGSYHFGNST       480
     YNMNSQ                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page