(data stored in ACNUC16935 zone)

EMBL: BN001307.PE339

BN001307.PE339       Location/Qualifiers
FT   CDS             complement(join(929434..929520,929751..930137,
FT                   930172..930276,930376..930381))
FT                   /locus_tag="ANIA_01499"
FT                   /old_locus_tag="AN1499.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008124"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008124"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008124"
FT                   /db_xref="GOA:Q5BD81"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD81"
FT                   /protein_id="CBF84991.1"
FT                   /translation="MSRFLRQDIQRRLLRLLTLKPFRLLPPHGPQAANDEPQCKPSLNH
FT                   YNNRPVLILALIIFIMGPRHFVRCLPDLLLYPPIRLTAPLAPSAFNLQCSTLDPQSRLL
FT                   RRRSLERTSMLTCQRPPQSPTNIEGMLSPPSAIGGVRVTLEILEGFDIDEPPRIPCQNR
FT                   FLKCEAIICLADDTRSRKKIVDGTFAKVVGA"
     MSRFLRQDIQ RRLLRLLTLK PFRLLPPHGP QAANDEPQCK PSLNHYNNRP VLILALIIFI        60
     MGPRHFVRCL PDLLLYPPIR LTAPLAPSAF NLQCSTLDPQ SRLLRRRSLE RTSMLTCQRP       120
     PQSPTNIEGM LSPPSAIGGV RVTLEILEGF DIDEPPRIPC QNRFLKCEAI ICLADDTRSR       180
     KKIVDGTFAK VVGA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page