(data stored in ACNUC16935 zone)

EMBL: BN001307.PE34

BN001307.PE34        Location/Qualifiers
FT   CDS             92996..94126
FT                   /locus_tag="ANIA_09028"
FT                   /old_locus_tag="AN9028.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007825"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007825"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007825"
FT                   /db_xref="GOA:Q5ARQ2"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ2"
FT                   /protein_id="CBF84432.1"
FT                   /translation="MAKTALITGANGITGSAILEYLVKNTTASEWERIIITSRSPLKTA
FT                   VNDSRVEFIALDFSNPPEKLADQMRSQCADVTHAYFSSYVHKDDFAELNEANRSLFENF
FT                   LNALVDVAKGLQNCTLQTGGKYYNVHVRPVPWPAHEGHPRLVRAEENFYYHQEDFLAEK
FT                   QRGSNWTWNVIRPEAIIGYTTKPNGMNEALTIALYFLINKELGVEAPMPTNAAYFNGVD
FT                   DVSDARLIADLTIYASTHKNCANEAFNVTNGDVFSWRYMWPRLADWFGAKASSNQSFNR
FT                   TSFKEGETHLDLNLEQWAQDKREVWNRLCDKAGSPLSKASFDAGTWTFQDWVFQRTWSS
FT                   PLSINKARKFGWTGHLDSFDSFVDAFKRFKELGQIP"
     MAKTALITGA NGITGSAILE YLVKNTTASE WERIIITSRS PLKTAVNDSR VEFIALDFSN        60
     PPEKLADQMR SQCADVTHAY FSSYVHKDDF AELNEANRSL FENFLNALVD VAKGLQNCTL       120
     QTGGKYYNVH VRPVPWPAHE GHPRLVRAEE NFYYHQEDFL AEKQRGSNWT WNVIRPEAII       180
     GYTTKPNGMN EALTIALYFL INKELGVEAP MPTNAAYFNG VDDVSDARLI ADLTIYASTH       240
     KNCANEAFNV TNGDVFSWRY MWPRLADWFG AKASSNQSFN RTSFKEGETH LDLNLEQWAQ       300
     DKREVWNRLC DKAGSPLSKA SFDAGTWTFQ DWVFQRTWSS PLSINKARKF GWTGHLDSFD       360
     SFVDAFKRFK ELGQIP                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page