(data stored in ACNUC16935 zone)

EMBL: BN001307.PE340

BN001307.PE340       Location/Qualifiers
FT   CDS             complement(join(930716..932166,932216..932657))
FT                   /locus_tag="ANIA_01500"
FT                   /old_locus_tag="AN1500.4"
FT                   /product="C2H2 finger domain protein, putative
FT                   (AFU_orthologue; AFUA_8G05010)"
FT                   /note="transcript_id=CADANIAT00008125"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008125"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008125"
FT                   /db_xref="GOA:Q5BD80"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD80"
FT                   /protein_id="CBF84993.1"
FT                   /translation="MMALEPSRQHQGPYFQDYSIDPALVDSFSFVDSLGAYGPDLTQPS
FT                   FQNTGFGDSYTDMGKQNFPVTTSEGFLSGVSTASGPSIASASSSAMGSPYSANTQTFQE
FT                   DWVDTTHGLSHPTAVMGDLFSNESMVNTFDAEGFYQKKSDSFVDPSLIQPMQQPQLTLT
FT                   PPAISYPEQPDYNLAPTSFYPQSPEPSRFHYAENYMPKQSFPQQSNLAPPSPIPSGPHS
FT                   RPASIYDRRSSISSIHSRPSQASPAPSGAEFEGDVKEKGRCPHPDCGRVFKDLKAHMLT
FT                   HQSERPEKCPIVTCEYHIKGFARKYDKNRHTLTHYKGTMVCGFCPGSGSPAEKSFNRAD
FT                   VFKRHLTSVHGVEQTPPNCRKKSPAASSAKSVSDYCQDATGKCSTCSGTFSNAQDFYEH
FT                   LDDCVLRVVQQEEPSEAINQQRLAEVESDEEVQKTMEKHRLLDTAGSVDQYDDENDDDD
FT                   DDDSDDRRPAKSAKTGKNSRVILGANNAISKSCSNNNSKNRLTASKRRNNRDHYPQSWG
FT                   CPSRNIKMKKRVLCVFDGQRRLWKDEMMLDNEFEVRLKLPGGAGDGTNREAYITDLDVE
FT                   TLKRANGILGATEEERGAWTEGTGGQLIGQPAMLLPDFSQNQEGDVVDIDELMA"
     MMALEPSRQH QGPYFQDYSI DPALVDSFSF VDSLGAYGPD LTQPSFQNTG FGDSYTDMGK        60
     QNFPVTTSEG FLSGVSTASG PSIASASSSA MGSPYSANTQ TFQEDWVDTT HGLSHPTAVM       120
     GDLFSNESMV NTFDAEGFYQ KKSDSFVDPS LIQPMQQPQL TLTPPAISYP EQPDYNLAPT       180
     SFYPQSPEPS RFHYAENYMP KQSFPQQSNL APPSPIPSGP HSRPASIYDR RSSISSIHSR       240
     PSQASPAPSG AEFEGDVKEK GRCPHPDCGR VFKDLKAHML THQSERPEKC PIVTCEYHIK       300
     GFARKYDKNR HTLTHYKGTM VCGFCPGSGS PAEKSFNRAD VFKRHLTSVH GVEQTPPNCR       360
     KKSPAASSAK SVSDYCQDAT GKCSTCSGTF SNAQDFYEHL DDCVLRVVQQ EEPSEAINQQ       420
     RLAEVESDEE VQKTMEKHRL LDTAGSVDQY DDENDDDDDD DSDDRRPAKS AKTGKNSRVI       480
     LGANNAISKS CSNNNSKNRL TASKRRNNRD HYPQSWGCPS RNIKMKKRVL CVFDGQRRLW       540
     KDEMMLDNEF EVRLKLPGGA GDGTNREAYI TDLDVETLKR ANGILGATEE ERGAWTEGTG       600
     GQLIGQPAML LPDFSQNQEG DVVDIDELMA                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page