(data stored in ACNUC16935 zone)

EMBL: BN001307.PE341

BN001307.PE341       Location/Qualifiers
FT   CDS             complement(join(937408..937530,937939..938094,
FT                   938375..938600,938687..938818,939204..939328))
FT                   /locus_tag="ANIA_01501"
FT                   /old_locus_tag="AN1501.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008126"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008126"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008126"
FT                   /db_xref="GOA:Q5BD79"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD79"
FT                   /protein_id="CBF84995.1"
FT                   /translation="MSSVACSWSRLSTEPLALLLPPIALLCSIVHPDSSLELLTRSRDL
FT                   DSAIVAVQDRLTRVIASTIFARDKDPYSVPIASIHGSFIRGEASPEFQAWALPVTHQEF
FT                   ASSSSLSIGEPPDPPLQCHEAPTELNPEYYHVAHSRPESPLAADKPWDSIPLALNALID
FT                   TNWGITAESKESALDRRVACQRTALNRLLRGQGMDGYAADELSWSCGENKRYRNSQSRR
FT                   MMIAVQPDCEKPQTVGSYFVLLVRILHIIRQ"
     MSSVACSWSR LSTEPLALLL PPIALLCSIV HPDSSLELLT RSRDLDSAIV AVQDRLTRVI        60
     ASTIFARDKD PYSVPIASIH GSFIRGEASP EFQAWALPVT HQEFASSSSL SIGEPPDPPL       120
     QCHEAPTELN PEYYHVAHSR PESPLAADKP WDSIPLALNA LIDTNWGITA ESKESALDRR       180
     VACQRTALNR LLRGQGMDGY AADELSWSCG ENKRYRNSQS RRMMIAVQPD CEKPQTVGSY       240
     FVLLVRILHI IRQ                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page