(data stored in ACNUC16935 zone)

EMBL: BN001307.PE342

BN001307.PE342       Location/Qualifiers
FT   CDS             complement(943464..945275)
FT                   /locus_tag="ANIA_01502"
FT                   /old_locus_tag="AN1502.4"
FT                   /product="N-acetylglucosaminidasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HGI3]"
FT                   /note="transcript_id=CADANIAT00008127"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008127"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008127"
FT                   /db_xref="GOA:G5EB27"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR029019"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB27"
FT                   /protein_id="CBF84996.1"
FT                   /translation="MAYFRLYAVLLAVASSVAAVKVNPLPAPRHISWGHSGPKPLSDVS
FT                   LRTERDTDDSILTNAWNRAWETIVSLEWVPAGIEAPIPEFDEFPTSTPSASAAATRSKR
FT                   ANVPIQFVDVDVEDWDADLQHGVDESYTLDAKAGSDAIDITAKTVWGALHAFTTLQQLV
FT                   ISDGNGGLILEQPVHIKDAPLYPYRGLMVDTGRNFISVRKLHEQLDGMALSKLNVLHWH
FT                   LDDTQSWPVHIDAYPEMTKDAYSARETYSHDDLRNVVAYARARGIRVIPEIDMPAHSAS
FT                   GWQQVDPDIVACANSWWSNDNWPLHTAVQPNPGQLDIINPKTYEVVQDVYEELSSIFTD
FT                   DWFHVGGDEIQPNCYNFSTYVTEWFQEDPSRTYNDLMQHWVDKAVPIFRSVSDSRRLVM
FT                   WEDVVLNTEHADDVPTDIVMQSWNNGLENINKLTERGYDVIVSSADFMYLDCGRGGYVT
FT                   NDDRYNEQTNPDPDTPSFNYGGIGGSWCGPYKTWQRIYNYDFTLNLTNAQAKHVIGATA
FT                   PLWSEQVDDVNISNLFWPRAAALAELVWSGNRDAKGNKRTTLFTQRILNFREYLLANGV
FT                   MAATVVPKYCLQHPHACDLNYDQTVLH"
     MAYFRLYAVL LAVASSVAAV KVNPLPAPRH ISWGHSGPKP LSDVSLRTER DTDDSILTNA        60
     WNRAWETIVS LEWVPAGIEA PIPEFDEFPT STPSASAAAT RSKRANVPIQ FVDVDVEDWD       120
     ADLQHGVDES YTLDAKAGSD AIDITAKTVW GALHAFTTLQ QLVISDGNGG LILEQPVHIK       180
     DAPLYPYRGL MVDTGRNFIS VRKLHEQLDG MALSKLNVLH WHLDDTQSWP VHIDAYPEMT       240
     KDAYSARETY SHDDLRNVVA YARARGIRVI PEIDMPAHSA SGWQQVDPDI VACANSWWSN       300
     DNWPLHTAVQ PNPGQLDIIN PKTYEVVQDV YEELSSIFTD DWFHVGGDEI QPNCYNFSTY       360
     VTEWFQEDPS RTYNDLMQHW VDKAVPIFRS VSDSRRLVMW EDVVLNTEHA DDVPTDIVMQ       420
     SWNNGLENIN KLTERGYDVI VSSADFMYLD CGRGGYVTND DRYNEQTNPD PDTPSFNYGG       480
     IGGSWCGPYK TWQRIYNYDF TLNLTNAQAK HVIGATAPLW SEQVDDVNIS NLFWPRAAAL       540
     AELVWSGNRD AKGNKRTTLF TQRILNFREY LLANGVMAAT VVPKYCLQHP HACDLNYDQT       600
     VLH                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page