(data stored in ACNUC16935 zone)

EMBL: BN001307.PE343

BN001307.PE343       Location/Qualifiers
FT   CDS             complement(946750..947679)
FT                   /locus_tag="ANIA_01503"
FT                   /old_locus_tag="AN1503.4"
FT                   /product="Dihydrodipicolinate synthase-like protein AN1503
FT                   (DHDPS-like protein)(EC 4.-.-.-)
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD77]"
FT                   /note="transcript_id=CADANIAT00008128"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008128"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008128"
FT                   /db_xref="GOA:Q5BD77"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD77"
FT                   /protein_id="CBF84998.1"
FT                   /translation="MANRPLVPGVYVPTVAFFAENEDVDVATVEKHAAYLAKSGVAGIV
FT                   VQGSNGEAVHLDREERNLITSATRHALDSVGATSMPVIVGTGAPSTRETINLCKDAAAA
FT                   GGDYVLVLPPSYYKSLVSSAALLDHFRAVADASPIPVLIYNFPGASAGLDLSSDDILAL
FT                   SSHPNIIGTKLTCGNTGKLTRIVAQAGPSFLTFGGSCDFTLQTLIGGGAGVIAGTANII
FT                   PRACVRIMELYRAGRVEEAQKVQAIVARADWLAIKGGFVAVKSALQSYRGYGQQPRRPC
FT                   VAPSSEEAAALKEAFSESIELERQLESQ"
     MANRPLVPGV YVPTVAFFAE NEDVDVATVE KHAAYLAKSG VAGIVVQGSN GEAVHLDREE        60
     RNLITSATRH ALDSVGATSM PVIVGTGAPS TRETINLCKD AAAAGGDYVL VLPPSYYKSL       120
     VSSAALLDHF RAVADASPIP VLIYNFPGAS AGLDLSSDDI LALSSHPNII GTKLTCGNTG       180
     KLTRIVAQAG PSFLTFGGSC DFTLQTLIGG GAGVIAGTAN IIPRACVRIM ELYRAGRVEE       240
     AQKVQAIVAR ADWLAIKGGF VAVKSALQSY RGYGQQPRRP CVAPSSEEAA ALKEAFSESI       300
     ELERQLESQ                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page