(data stored in ACNUC16935 zone)

EMBL: BN001307.PE344

BN001307.PE344       Location/Qualifiers
FT   CDS             join(949403..950049,950211..951103,951164..952134)
FT                   /locus_tag="ANIA_01504"
FT                   /old_locus_tag="AN1504.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008129"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008129"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008129"
FT                   /db_xref="GOA:C8VMN5"
FT                   /db_xref="InterPro:IPR029184"
FT                   /db_xref="InterPro:IPR038988"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMN5"
FT                   /protein_id="CBF85000.1"
FT                   /translation="MRKALVITATAISGLSLAVSLYLSHQKRYLASQVRHSSERGQLSP
FT                   STPRNVSSISSDIFSSEYYTLYDYASISAPRHSLPDLEPSQLLIALLRRNMSSFASSPQ
FT                   ARLLKLAASDPETIRSFDRAHIVALDFDEGDLVCNAYRVRLRAPEKVEFEFLFGVQGRL
FT                   VVSVEVKGEDMVFHNETLMWRDKDTKNKLPLENGFANWVHELTAWWMLESGISFELTRS
FT                   GHSCHSSRIQFPLPRVISHRHRALMRPERVEEIPSRFPPLPTDPMTSTAIMPARSRSSL
FT                   RALRRDPNATNDDSAGVQPPPPKRPRLNLFPSRRRKSSPDLLDTTIDSSPSTSSTKLRR
FT                   PRPLLAHSAHTTSSPPSGSSTPHARNLRQHHTPNSSSAALYLNGGRESPDPLDTISPAP
FT                   ALKPSTITTSTPTPTSAAYRQRRLTQYLKPASEQAVKDSSKSKNTRPARGSTVPPPSDE
FT                   SAPQSLTVPSETADRAVPEKRRSLRSHDGGSRAKSELALYFPNYDQIMSLEPPKTELLS
FT                   ENTVIKLIDDLAEPLDLSSAPSSSDADAPFGNPLVNLYKCDVITLPDTQLKNESRPDIE
FT                   AGEAEEDDPLNDEFYFKAHRRHERQEKQLRNIERDRARHDQQQLDRLLDELQGHDWLRV
FT                   MGITGRSLSEQDKKLYEPKRDYFIAEISTLLQKFKIWKEEEKRRKLDKDYKSASFHSDA
FT                   AEPSYGNAKDNDRKDDDEEATAEPTSDDVDALAARQLLQEARSATAGKQPKSKLEQQEL
FT                   AQSAPPPLPGLPKPFTSFFAKPHLRAQAMSGNRKGRTRLAFGHLIPELGERDFELPGDI
FT                   LTPEAIKDCQRKRRRMKRDKASSG"
     MRKALVITAT AISGLSLAVS LYLSHQKRYL ASQVRHSSER GQLSPSTPRN VSSISSDIFS        60
     SEYYTLYDYA SISAPRHSLP DLEPSQLLIA LLRRNMSSFA SSPQARLLKL AASDPETIRS       120
     FDRAHIVALD FDEGDLVCNA YRVRLRAPEK VEFEFLFGVQ GRLVVSVEVK GEDMVFHNET       180
     LMWRDKDTKN KLPLENGFAN WVHELTAWWM LESGISFELT RSGHSCHSSR IQFPLPRVIS       240
     HRHRALMRPE RVEEIPSRFP PLPTDPMTST AIMPARSRSS LRALRRDPNA TNDDSAGVQP       300
     PPPKRPRLNL FPSRRRKSSP DLLDTTIDSS PSTSSTKLRR PRPLLAHSAH TTSSPPSGSS       360
     TPHARNLRQH HTPNSSSAAL YLNGGRESPD PLDTISPAPA LKPSTITTST PTPTSAAYRQ       420
     RRLTQYLKPA SEQAVKDSSK SKNTRPARGS TVPPPSDESA PQSLTVPSET ADRAVPEKRR       480
     SLRSHDGGSR AKSELALYFP NYDQIMSLEP PKTELLSENT VIKLIDDLAE PLDLSSAPSS       540
     SDADAPFGNP LVNLYKCDVI TLPDTQLKNE SRPDIEAGEA EEDDPLNDEF YFKAHRRHER       600
     QEKQLRNIER DRARHDQQQL DRLLDELQGH DWLRVMGITG RSLSEQDKKL YEPKRDYFIA       660
     EISTLLQKFK IWKEEEKRRK LDKDYKSASF HSDAAEPSYG NAKDNDRKDD DEEATAEPTS       720
     DDVDALAARQ LLQEARSATA GKQPKSKLEQ QELAQSAPPP LPGLPKPFTS FFAKPHLRAQ       780
     AMSGNRKGRT RLAFGHLIPE LGERDFELPG DILTPEAIKD CQRKRRRMKR DKASSG           836
//

If you have problems or comments...

PBIL Back to PBIL home page