(data stored in ACNUC16935 zone)

EMBL: BN001307.PE345

BN001307.PE345       Location/Qualifiers
FT   CDS             complement(join(952617..953042,953098..953312,
FT                   953368..953511,953565..953896,953978..954064,
FT                   954134..954342))
FT                   /locus_tag="ANIA_01505"
FT                   /old_locus_tag="AN1505.4"
FT                   /product="amino acid transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008130"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008130"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008130"
FT                   /db_xref="GOA:Q5BD75"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD75"
FT                   /protein_id="CBF85002.1"
FT                   /translation="MAQNAESSVPYGHEESGPEKNVTTDEDSFTRDDVKKTENSPPPYT
FT                   QSPFTSDAFGDEEFAEVKYKTLKWWQCGLLMVAETVSLGVLSLPAAVAGLGFVPAIIIL
FT                   VALGLFATYTGYVIGQFKNRFPHVTNMADAGEVVAGKWGREFMGVAQMLFFVFVMASHL
FT                   LTFTVAMNTLTEHGTCSIVFGVVGMIVSFILCLPRTLEKMSWLSLVSFISIFSAVMICM
FT                   VGVGISKPGVNNTAAVVDTDLYHGFTAVTNIVFAFCGHAAFFGLAAELKDPRDFPKGLC
FT                   LLQGIDISLYLIAAVVIYRYGGADVTSPALGSASPIVSKVAYGIALPTILIAGVIYGHV
FT                   AAKYIYIRIFRGTDRMHKRDAVAIGSWVVIALCLWILAWIIAEAIPVFSNLLSLITALF
FT                   ASWFTYGLSGIFWLFMNKGLWFKNWKKISLTMVNLLAIGVACVLCGMGLWVSGKALHDN
FT                   PSSASFSCANNA"
     MAQNAESSVP YGHEESGPEK NVTTDEDSFT RDDVKKTENS PPPYTQSPFT SDAFGDEEFA        60
     EVKYKTLKWW QCGLLMVAET VSLGVLSLPA AVAGLGFVPA IIILVALGLF ATYTGYVIGQ       120
     FKNRFPHVTN MADAGEVVAG KWGREFMGVA QMLFFVFVMA SHLLTFTVAM NTLTEHGTCS       180
     IVFGVVGMIV SFILCLPRTL EKMSWLSLVS FISIFSAVMI CMVGVGISKP GVNNTAAVVD       240
     TDLYHGFTAV TNIVFAFCGH AAFFGLAAEL KDPRDFPKGL CLLQGIDISL YLIAAVVIYR       300
     YGGADVTSPA LGSASPIVSK VAYGIALPTI LIAGVIYGHV AAKYIYIRIF RGTDRMHKRD       360
     AVAIGSWVVI ALCLWILAWI IAEAIPVFSN LLSLITALFA SWFTYGLSGI FWLFMNKGLW       420
     FKNWKKISLT MVNLLAIGVA CVLCGMGLWV SGKALHDNPS SASFSCANNA                  470
//

If you have problems or comments...

PBIL Back to PBIL home page