(data stored in ACNUC16935 zone)

EMBL: BN001307.PE347

BN001307.PE347       Location/Qualifiers
FT   CDS             complement(join(957522..958130,958179..958211))
FT                   /locus_tag="ANIA_01507"
FT                   /old_locus_tag="AN1507.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008132"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008132"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008132"
FT                   /db_xref="GOA:Q5BD73"
FT                   /db_xref="InterPro:IPR024526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD73"
FT                   /protein_id="CBF85006.1"
FT                   /translation="MAHVHIPTVTLEDLQAFQAKHFPATVKPQPLQSTSYPTHDAYNED
FT                   FYANADEEDVDDEDDDLGYYPDGVKRTLTDEQIRIFRHSEIHALLREKQIKQENEEYEK
FT                   GLGGKTEAQPEAGAQVHTSLDERDGAISAPPKDVAKAVAGRKRCADKVGCDAGADEPVL
FT                   KRKPTSDSGAPSEVQLDYNEESAAAPTTASQSRATRATPFMGRRIISYDD"
     MAHVHIPTVT LEDLQAFQAK HFPATVKPQP LQSTSYPTHD AYNEDFYANA DEEDVDDEDD        60
     DLGYYPDGVK RTLTDEQIRI FRHSEIHALL REKQIKQENE EYEKGLGGKT EAQPEAGAQV       120
     HTSLDERDGA ISAPPKDVAK AVAGRKRCAD KVGCDAGADE PVLKRKPTSD SGAPSEVQLD       180
     YNEESAAAPT TASQSRATRA TPFMGRRIIS YDD                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page