(data stored in ACNUC16935 zone)

EMBL: BN001307.PE348

BN001307.PE348       Location/Qualifiers
FT   CDS             complement(join(958666..959065,959096..959184,
FT                   959232..959344,959395..959647))
FT                   /locus_tag="ANIA_01508"
FT                   /old_locus_tag="AN1508.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008133"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008133"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008133"
FT                   /db_xref="GOA:Q5BD72"
FT                   /db_xref="InterPro:IPR027521"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD72"
FT                   /protein_id="CBF85007.1"
FT                   /translation="MALVQYSDSESDSEKEAPPRKINKPSQNLSHNPASTLPPLPASFH
FT                   DLYASSVKVSVRDDPSLHGGRKRVIPHVEGNWPTHIYLEWYPSKKELEILGNIIRQAEH
FT                   MFRAEQAKLNSFLYSDLGNGGEAAVYGHIWSGTKWLWHLTVCAICPSVFEVQIDSLDWV
FT                   SNFERTRWFYVLRVKRPEGDGLNRLLHISNRSLGLFNQPPLYAPLFNSKSGTQPSIRVS
FT                   KPTSTGDYTECFHISIAWSLEEPSAEEKKSMESIDIQRLKALKIKFDCLKAKIGNNVSS
FT                   IPL"
     MALVQYSDSE SDSEKEAPPR KINKPSQNLS HNPASTLPPL PASFHDLYAS SVKVSVRDDP        60
     SLHGGRKRVI PHVEGNWPTH IYLEWYPSKK ELEILGNIIR QAEHMFRAEQ AKLNSFLYSD       120
     LGNGGEAAVY GHIWSGTKWL WHLTVCAICP SVFEVQIDSL DWVSNFERTR WFYVLRVKRP       180
     EGDGLNRLLH ISNRSLGLFN QPPLYAPLFN SKSGTQPSIR VSKPTSTGDY TECFHISIAW       240
     SLEEPSAEEK KSMESIDIQR LKALKIKFDC LKAKIGNNVS SIPL                        284
//

If you have problems or comments...

PBIL Back to PBIL home page