(data stored in ACNUC16935 zone)

EMBL: BN001307.PE349

BN001307.PE349       Location/Qualifiers
FT   CDS             join(962232..962813,962867..962983)
FT                   /locus_tag="ANIA_01509"
FT                   /old_locus_tag="AN1509.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008134"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008134"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008134"
FT                   /db_xref="GOA:Q5BD71"
FT                   /db_xref="InterPro:IPR013226"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD71"
FT                   /protein_id="CBF85009.1"
FT                   /translation="MQQYQMDHAYPMPGSQSPKSISSASLGSGSPYQRFLSPSPSPTRS
FT                   TRRRSRTTSVLPADYAYADILFDASQHNRGRRSRRSGLNARRSQLVKPDVIDRMDTAAQ
FT                   FSYHHEGPYDAVYPERNRISIHSPLDALRESNEEALKATPRHMIADAIGRRRPLDGVAF
FT                   YPPGYTDPEGQTYDYEEGPNLMADCCLFPRQRFTDEDFRNDPFTNTPVKPFAPLRNVFR
FT                   RTPRKHRNTA"
     MQQYQMDHAY PMPGSQSPKS ISSASLGSGS PYQRFLSPSP SPTRSTRRRS RTTSVLPADY        60
     AYADILFDAS QHNRGRRSRR SGLNARRSQL VKPDVIDRMD TAAQFSYHHE GPYDAVYPER       120
     NRISIHSPLD ALRESNEEAL KATPRHMIAD AIGRRRPLDG VAFYPPGYTD PEGQTYDYEE       180
     GPNLMADCCL FPRQRFTDED FRNDPFTNTP VKPFAPLRNV FRRTPRKHRN TA               232
//

If you have problems or comments...

PBIL Back to PBIL home page