(data stored in ACNUC16935 zone)

EMBL: BN001307.PE35

BN001307.PE35        Location/Qualifiers
FT   CDS             join(94636..94668,94719..94733,94792..94842,94901..95279,
FT                   95358..95488,95545..95775)
FT                   /locus_tag="ANIA_09027"
FT                   /old_locus_tag="AN9027.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007826"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007826"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007826"
FT                   /db_xref="GOA:Q5ARQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ3"
FT                   /protein_id="CBF84434.1"
FT                   /translation="MSSVNIDQAPQGTKLWLLHLGYVEADEGFFLAGAGTSTMTNPNCK
FT                   NPRRKLVLTSALIDHPIEGLILFETGPGEAYPEVWGPPVNDIFGRVDYSPEHELEAALA
FT                   KSGHSIKDIKAVIMGHLHIDHAGGLEKFSGTDIPIYVHEEELKHAFYSVATKSDAGVYH
FT                   GKDLDAKLNWTAIHGETFELAQGITLRHAPGHTPGLVLMQVNLPDSGTWLFTTDQYHVS
FT                   ENYEQSIPHGWLARDYHAWVKTHQMVKTIAKRTNANLVFGHDLGVFFQYEHAPHAYT"
     MSSVNIDQAP QGTKLWLLHL GYVEADEGFF LAGAGTSTMT NPNCKNPRRK LVLTSALIDH        60
     PIEGLILFET GPGEAYPEVW GPPVNDIFGR VDYSPEHELE AALAKSGHSI KDIKAVIMGH       120
     LHIDHAGGLE KFSGTDIPIY VHEEELKHAF YSVATKSDAG VYHGKDLDAK LNWTAIHGET       180
     FELAQGITLR HAPGHTPGLV LMQVNLPDSG TWLFTTDQYH VSENYEQSIP HGWLARDYHA       240
     WVKTHQMVKT IAKRTNANLV FGHDLGVFFQ YEHAPHAYT                              279
//

If you have problems or comments...

PBIL Back to PBIL home page