(data stored in ACNUC16935 zone)

EMBL: BN001307.PE351

BN001307.PE351       Location/Qualifiers
FT   CDS             join(967001..967052,967114..967617,967667..968421)
FT                   /locus_tag="ANIA_01511"
FT                   /old_locus_tag="AN1511.4"
FT                   /product="microbody (peroxisome) biogenesis protein peroxin
FT                   13 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008136"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008136"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008136"
FT                   /db_xref="GOA:Q5BD69"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR007223"
FT                   /db_xref="InterPro:IPR035463"
FT                   /db_xref="InterPro:IPR036028"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD69"
FT                   /protein_id="CBF85013.1"
FT                   /translation="MASVSPPKPWERAGATAGTALSSPATTSTAMSSTSTTSAAPTAGT
FT                   STTSATAPPSLPSRPSTLSTVANQNASNYSPYGASRFGASPYGGYGGYGSYSSPYSRFG
FT                   GMGSMYGGYGGYGGMYSGMGGYGGMYGGGMPGDPNDPNSLTNSFNQSTQATFQMIESIV
FT                   GAFGGFAQMLESTYMATHSSFFAMVSVAEQFGNLRNTLGSALGIFTLIRWFKTLIAKIT
FT                   GRPPPADATALTPAAFAAFMGGRATLPDGSPAPPRPSRKPFLMFLVALFGLPYLMGKLI
FT                   KSLARSQEAQRQKIMMTANGEQQGVLDPSKLDFCRVLYDYTPESQETNGIDLAVKKGDI
FT                   VAVLSKSDPMGNASEWWRCRARDGRVGYLPGPYLETIQRKPQQQALTSGSEAGSRSNTM
FT                   QSQTQVGNEVAAGQKPELKGKMGDISAESFQKSAFYS"
     MASVSPPKPW ERAGATAGTA LSSPATTSTA MSSTSTTSAA PTAGTSTTSA TAPPSLPSRP        60
     STLSTVANQN ASNYSPYGAS RFGASPYGGY GGYGSYSSPY SRFGGMGSMY GGYGGYGGMY       120
     SGMGGYGGMY GGGMPGDPND PNSLTNSFNQ STQATFQMIE SIVGAFGGFA QMLESTYMAT       180
     HSSFFAMVSV AEQFGNLRNT LGSALGIFTL IRWFKTLIAK ITGRPPPADA TALTPAAFAA       240
     FMGGRATLPD GSPAPPRPSR KPFLMFLVAL FGLPYLMGKL IKSLARSQEA QRQKIMMTAN       300
     GEQQGVLDPS KLDFCRVLYD YTPESQETNG IDLAVKKGDI VAVLSKSDPM GNASEWWRCR       360
     ARDGRVGYLP GPYLETIQRK PQQQALTSGS EAGSRSNTMQ SQTQVGNEVA AGQKPELKGK       420
     MGDISAESFQ KSAFYS                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page