(data stored in ACNUC16935 zone)

EMBL: BN001307.PE353

BN001307.PE353       Location/Qualifiers
FT   CDS             complement(join(971084..971293,971343..972313,
FT                   972381..972696))
FT                   /locus_tag="ANIA_10212"
FT                   /old_locus_tag="AN10212.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008138"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008138"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008138"
FT                   /db_xref="GOA:C8VMP4"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP4"
FT                   /protein_id="CBF85017.1"
FT                   /translation="MDSPVLNQLFRQLFRHPACQSVRPSPSSHTFRLSRSQQQCRPFLT
FT                   RRSAAKRKSTDDGLNWTKRGDYPKNIDEELKTYPLMAAKDLRHRQDRPRQVQMLTREFI
FT                   DDSLYNPHYGYFSKHATIFSPGEPFDFNNIEDGPAFHRLLGERYTEFEDMLDEKQPDEA
FT                   RQLWHTPTELFRPYYGETIARYLVSNYKLTLYPYHDLIIYEMGAGNGTMMINILDFIRD
FT                   TDYEVYQRTKFRIIEISPALAGLQMKNLTDSLYAAGHLDHVEIINKSIFEWDTYVHSPC
FT                   FFLALEVFDNFAHDAIRYDTKTEMPQQGGVLIDGDGEFHEFWTPKLDPLASRFLRVRQA
FT                   AARREFPSPLGPRLARQIRGTLPFQKPYTMPEYIPTRLMQFFDILDNYFPGHRLLASDF
FT                   SSLPDAIPGINAPVVQTRYKRRTVPVSTPFVHQGYFDIFFPTDFNVVEDIYRAITGKLT
FT                   QVASHEDFVRRWAYVEDTETRSGENPLLTWYKNASMLMTV"
     MDSPVLNQLF RQLFRHPACQ SVRPSPSSHT FRLSRSQQQC RPFLTRRSAA KRKSTDDGLN        60
     WTKRGDYPKN IDEELKTYPL MAAKDLRHRQ DRPRQVQMLT REFIDDSLYN PHYGYFSKHA       120
     TIFSPGEPFD FNNIEDGPAF HRLLGERYTE FEDMLDEKQP DEARQLWHTP TELFRPYYGE       180
     TIARYLVSNY KLTLYPYHDL IIYEMGAGNG TMMINILDFI RDTDYEVYQR TKFRIIEISP       240
     ALAGLQMKNL TDSLYAAGHL DHVEIINKSI FEWDTYVHSP CFFLALEVFD NFAHDAIRYD       300
     TKTEMPQQGG VLIDGDGEFH EFWTPKLDPL ASRFLRVRQA AARREFPSPL GPRLARQIRG       360
     TLPFQKPYTM PEYIPTRLMQ FFDILDNYFP GHRLLASDFS SLPDAIPGIN APVVQTRYKR       420
     RTVPVSTPFV HQGYFDIFFP TDFNVVEDIY RAITGKLTQV ASHEDFVRRW AYVEDTETRS       480
     GENPLLTWYK NASMLMTV                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page