(data stored in ACNUC16935 zone)

EMBL: BN001307.PE354

BN001307.PE354       Location/Qualifiers
FT   CDS             join(972915..973202,973260..973319,973366..973484,
FT                   973533..974179,974231..974403)
FT                   /locus_tag="ANIA_01513"
FT                   /old_locus_tag="AN1513.4"
FT                   /product="hypothetical transmembrane protein (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008139"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008139"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008139"
FT                   /db_xref="GOA:Q5BD67"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD67"
FT                   /protein_id="CBF85019.1"
FT                   /translation="MPDHSHIYIGSAFVAGVVLTIAFKDLFYPEIEERIRDYRARHSSK
FT                   SYQNASVDSLAVRHGPPAIVDGIEGCIGNTPLLRIKSLSEATGCEILAKAEFLNGAGQS
FT                   SKDRVALSMIELAEERGLMTPHSGDTIYEGTSGSTGISLATLARAKGYLAHICMPSDQA
FT                   IEKSNLLLKLGAIVDRVPPAPIVEKDNFVNRARALAQAHTNSTASESSVGTASQRGRGY
FT                   FADQFENEANWRAHYNGTGPEIYAQCNGSLDAFVAGAGTGGTISGVALYLKPRIPNMTV
FT                   VVADPQGSGLYNRVRYGVMFDTKEKEGTRRRRQVDTIVEGIGINRVTANFEAGRELVDD
FT                   AVRVTDAQALAMARWLVEKDGIFAGSSSAVNCFAAVKTALKLGPGHRIVTMLSDSGSRH
FT                   LSRFWAKAGNVGGAVDTKLEDVLNAKEDQ"
     MPDHSHIYIG SAFVAGVVLT IAFKDLFYPE IEERIRDYRA RHSSKSYQNA SVDSLAVRHG        60
     PPAIVDGIEG CIGNTPLLRI KSLSEATGCE ILAKAEFLNG AGQSSKDRVA LSMIELAEER       120
     GLMTPHSGDT IYEGTSGSTG ISLATLARAK GYLAHICMPS DQAIEKSNLL LKLGAIVDRV       180
     PPAPIVEKDN FVNRARALAQ AHTNSTASES SVGTASQRGR GYFADQFENE ANWRAHYNGT       240
     GPEIYAQCNG SLDAFVAGAG TGGTISGVAL YLKPRIPNMT VVVADPQGSG LYNRVRYGVM       300
     FDTKEKEGTR RRRQVDTIVE GIGINRVTAN FEAGRELVDD AVRVTDAQAL AMARWLVEKD       360
     GIFAGSSSAV NCFAAVKTAL KLGPGHRIVT MLSDSGSRHL SRFWAKAGNV GGAVDTKLED       420
     VLNAKEDQ                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page