(data stored in ACNUC16935 zone)

EMBL: BN001307.PE355

BN001307.PE355       Location/Qualifiers
FT   CDS             complement(974629..976368)
FT                   /locus_tag="ANIA_01514"
FT                   /old_locus_tag="AN1514.4"
FT                   /product="Myb-like DNA-binding domain protein
FT                   (AFU_orthologue; AFUA_8G05190)"
FT                   /note="transcript_id=CADANIAT00008140"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008140"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008140"
FT                   /db_xref="GOA:Q5BD66"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR018465"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD66"
FT                   /protein_id="CBF85020.1"
FT                   /translation="MGSPLKRKRLYLWSGADDEYETSDIDLQEARTQNDLRLKSIFEGI
FT                   FEKYGRDFTDVGDEIDLQTGKITVNNGHIDALEVEGNGYGDWLSDARPQAPRHVLAERT
FT                   DYEGKPARLALDADAWGAEDTALEGDHDLQHPGRRTVHLLSHMRPGSRRGLGETTETDS
FT                   DQGAAGDGEDRATSEAEDDRSSVDSLLGTALSIPAQKVGKTTKGETGTEKAIPPHDGSH
FT                   QYQAAHTERLDETVDPIWRVPEISAKFTTPTLPSRPRPNPKPVINNAVRSQSPPGASSV
FT                   WALSGTRKRDTDVVKKIKQKGSPKRRVKHHSSPDAVWDWSFADAPDGSESDDPLQEDYV
FT                   PSPTPKDSVYIREKRKGPFSAGAAQKTCSFCKRIFSRKAYDMHLKDVLANPADNEHDSV
FT                   ELKRQLATVTGDGTTESAPGATNRSPAPAGLIVRITNTPREPDSEAGQRTNHESTPTGS
FT                   KRARTVLGPQEARLIIQMRHIQGMKWKEISDHFPQKKPANIQAWHHVHWKQRKANPPRL
FT                   SGPWSKAELEKLEILKDQPELTWPGIRAEFPGRLLAEIEFKLLQLWAGDNVSQPLRSAS
FT                   PAD"
     MGSPLKRKRL YLWSGADDEY ETSDIDLQEA RTQNDLRLKS IFEGIFEKYG RDFTDVGDEI        60
     DLQTGKITVN NGHIDALEVE GNGYGDWLSD ARPQAPRHVL AERTDYEGKP ARLALDADAW       120
     GAEDTALEGD HDLQHPGRRT VHLLSHMRPG SRRGLGETTE TDSDQGAAGD GEDRATSEAE       180
     DDRSSVDSLL GTALSIPAQK VGKTTKGETG TEKAIPPHDG SHQYQAAHTE RLDETVDPIW       240
     RVPEISAKFT TPTLPSRPRP NPKPVINNAV RSQSPPGASS VWALSGTRKR DTDVVKKIKQ       300
     KGSPKRRVKH HSSPDAVWDW SFADAPDGSE SDDPLQEDYV PSPTPKDSVY IREKRKGPFS       360
     AGAAQKTCSF CKRIFSRKAY DMHLKDVLAN PADNEHDSVE LKRQLATVTG DGTTESAPGA       420
     TNRSPAPAGL IVRITNTPRE PDSEAGQRTN HESTPTGSKR ARTVLGPQEA RLIIQMRHIQ       480
     GMKWKEISDH FPQKKPANIQ AWHHVHWKQR KANPPRLSGP WSKAELEKLE ILKDQPELTW       540
     PGIRAEFPGR LLAEIEFKLL QLWAGDNVSQ PLRSASPAD                              579
//

If you have problems or comments...

PBIL Back to PBIL home page