(data stored in ACNUC16935 zone)

EMBL: BN001307.PE356

BN001307.PE356       Location/Qualifiers
FT   CDS             join(976888..976972,977039..978564)
FT                   /locus_tag="ANIA_10213"
FT                   /old_locus_tag="AN10213.4"
FT                   /product="autophagy protein Apg6, putative (AFU_orthologue;
FT                   AFUA_8G05170)"
FT                   /note="transcript_id=CADANIAT00008141"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008141"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008141"
FT                   /db_xref="GOA:C8VMP7"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="InterPro:IPR038274"
FT                   /db_xref="InterPro:IPR040455"
FT                   /db_xref="InterPro:IPR041691"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP7"
FT                   /protein_id="CBF85022.1"
FT                   /translation="MYCQKCRTPLKLDGSLEALNPAAFDLLIGSTGKAVPDPSTGSSRL
FT                   SYPQERRDLYDRVSKNASSPVYRRSIPAPRQSGGSSATPSRLGRGDSGNMSFVMLTESQ
FT                   LGPSHTIPGVNGDSASSKGKRASGVQGDDSGADNGSFAEQVERTCRLFEIISARSDIDH
FT                   PICTECTDMLVEGLQQRLAEATKERDAYITFLRNLNSSVPTQEEVETAEKSLKETLEAE
FT                   EAAYAELVALEKENAALDEEIARLEEESRQLDYEEEKFWRDRNAFSLVLADFQNERDAL
FT                   NMKYDHDSRQLERLQRTNVYNDAFCIGHDGYFGTINGLRLGRLANPSVEWPEINAAWGQ
FT                   TALLLATIAEKLNFQFQGYRLRPMGSMSRIDKIEYPRPSPAQSTVEGASNAHQPAAPKI
FT                   TSLDLFSSGDLPLHIPWLHRRFDAGMVAFLECLRQLGEFVEKTPVRSSRRDQAGAVLPG
FT                   LKLPYAIKRDKIGDASIKLGFNQNDETWTRACKYTLTCCKFLLAHASNIASAGSTNSAA
FT                   VTAATVAEQARVAPSPTNK"
     MYCQKCRTPL KLDGSLEALN PAAFDLLIGS TGKAVPDPST GSSRLSYPQE RRDLYDRVSK        60
     NASSPVYRRS IPAPRQSGGS SATPSRLGRG DSGNMSFVML TESQLGPSHT IPGVNGDSAS       120
     SKGKRASGVQ GDDSGADNGS FAEQVERTCR LFEIISARSD IDHPICTECT DMLVEGLQQR       180
     LAEATKERDA YITFLRNLNS SVPTQEEVET AEKSLKETLE AEEAAYAELV ALEKENAALD       240
     EEIARLEEES RQLDYEEEKF WRDRNAFSLV LADFQNERDA LNMKYDHDSR QLERLQRTNV       300
     YNDAFCIGHD GYFGTINGLR LGRLANPSVE WPEINAAWGQ TALLLATIAE KLNFQFQGYR       360
     LRPMGSMSRI DKIEYPRPSP AQSTVEGASN AHQPAAPKIT SLDLFSSGDL PLHIPWLHRR       420
     FDAGMVAFLE CLRQLGEFVE KTPVRSSRRD QAGAVLPGLK LPYAIKRDKI GDASIKLGFN       480
     QNDETWTRAC KYTLTCCKFL LAHASNIASA GSTNSAAVTA ATVAEQARVA PSPTNK           536
//

If you have problems or comments...

PBIL Back to PBIL home page