(data stored in ACNUC16935 zone)

EMBL: BN001307.PE357

BN001307.PE357       Location/Qualifiers
FT   CDS             join(988148..988412,988466..989115)
FT                   /locus_tag="ANIA_01515"
FT                   /old_locus_tag="AN1515.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008142"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008142"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008142"
FT                   /db_xref="GOA:C8VMP8"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMP8"
FT                   /protein_id="CBF85024.1"
FT                   /translation="MLRDLLRDLVKFVPWAALLPLVRAEGTVQDLWNSPQYPDYTTNYT
FT                   AGTTIEISWQHALSYQFQYFCESCDVTNVDLWVTGSSYTRKLEAGMNVNETTSYEWTIN
FT                   LDNADVEASTQWTFRFLPADVSWGDNQEEISSARFNLLPRSDSSSTTTSSTSTSTSSST
FT                   TATSNPNATPTTDSATDGESSSTENHNDGLSTGAKAGIGVGVSAGAIILAALAFLLWRR
FT                   IKALPSTNAVGPEGPNGGYSQVHQGYFADPPMVKAAPVPASGVVAPMSELAGDHAGEMD
FT                   AGADARRPPVELDGSELYSHHGR"
     MLRDLLRDLV KFVPWAALLP LVRAEGTVQD LWNSPQYPDY TTNYTAGTTI EISWQHALSY        60
     QFQYFCESCD VTNVDLWVTG SSYTRKLEAG MNVNETTSYE WTINLDNADV EASTQWTFRF       120
     LPADVSWGDN QEEISSARFN LLPRSDSSST TTSSTSTSTS SSTTATSNPN ATPTTDSATD       180
     GESSSTENHN DGLSTGAKAG IGVGVSAGAI ILAALAFLLW RRIKALPSTN AVGPEGPNGG       240
     YSQVHQGYFA DPPMVKAAPV PASGVVAPMS ELAGDHAGEM DAGADARRPP VELDGSELYS       300
     HHGR                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page