(data stored in ACNUC16935 zone)

EMBL: BN001307.PE359

BN001307.PE359       Location/Qualifiers
FT   CDS             complement(join(992454..994253,994313..994480))
FT                   /locus_tag="ANIA_10215"
FT                   /old_locus_tag="AN10215.4"
FT                   /product="peroxisomal targeting signal (PTS1) receptor
FT                   protein peroxin 5 (Eurofung)"
FT                   /note="transcript_id=CADANIAT00008144"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008144"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008144"
FT                   /db_xref="GOA:C8VMQ0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024111"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ0"
FT                   /protein_id="CBF85028.1"
FT                   /translation="MSFLGGAECSTAGNPLTQFTKHVQDDKSLQRDRLVGRAPGMQEGM
FT                   RSQGMMGGHDQMMDEFAQQSAQLPGGPQQHMRMEMEQVRQQLEQMHTTPRTGSPGWAAE
FT                   FDPGEQARMEAAFAGPKGPMMNNGSGFTPAEFARFQQQSTMSVPQSASPVTAGQSPMMG
FT                   GYQRSMGMGYMGYGGMGMMQPGFGPMGMQHQQPAEASTQDKGKGRMIELDDENWEAQFK
FT                   EIETADQGKLDDEANAAIEAELNDLDRSVPTTSSTEDLSHFERVWERVQAETATNRKLA
FT                   EDSEYNIDDNLHMGDMAEWDGFDNLNTRFREPRLGDYSFEQENVFRDIANPFEEGMKIM
FT                   QEGGNLSLAALAFEAAVQKDPQHVKAWTMLGTAQAQNEKELPAIRALEQALKVDPNNLD
FT                   ALMGLAVSYTNEGYDSTAYRTLERWLSVKYPQIISRDDLSSDADLGFTDRQILHERVTD
FT                   LFIQAAQLSPSGAQMDPDVQVGLGVLFYCAEEYEKAVDCFTTALASTESGTTNQREQLH
FT                   LLWNRLGATLANSGRSEEAIEAYEQALNINPNFVRARYNLGVSCINIGCYPEAAQHLLG
FT                   ALSMHRVVEEEGKERAREIVGGNDGRINEAELNRMITANQSTNLYDTLRRVFSQMGRRD
FT                   LADLVEAGMDVNIFRKEFEF"
     MSFLGGAECS TAGNPLTQFT KHVQDDKSLQ RDRLVGRAPG MQEGMRSQGM MGGHDQMMDE        60
     FAQQSAQLPG GPQQHMRMEM EQVRQQLEQM HTTPRTGSPG WAAEFDPGEQ ARMEAAFAGP       120
     KGPMMNNGSG FTPAEFARFQ QQSTMSVPQS ASPVTAGQSP MMGGYQRSMG MGYMGYGGMG       180
     MMQPGFGPMG MQHQQPAEAS TQDKGKGRMI ELDDENWEAQ FKEIETADQG KLDDEANAAI       240
     EAELNDLDRS VPTTSSTEDL SHFERVWERV QAETATNRKL AEDSEYNIDD NLHMGDMAEW       300
     DGFDNLNTRF REPRLGDYSF EQENVFRDIA NPFEEGMKIM QEGGNLSLAA LAFEAAVQKD       360
     PQHVKAWTML GTAQAQNEKE LPAIRALEQA LKVDPNNLDA LMGLAVSYTN EGYDSTAYRT       420
     LERWLSVKYP QIISRDDLSS DADLGFTDRQ ILHERVTDLF IQAAQLSPSG AQMDPDVQVG       480
     LGVLFYCAEE YEKAVDCFTT ALASTESGTT NQREQLHLLW NRLGATLANS GRSEEAIEAY       540
     EQALNINPNF VRARYNLGVS CINIGCYPEA AQHLLGALSM HRVVEEEGKE RAREIVGGND       600
     GRINEAELNR MITANQSTNL YDTLRRVFSQ MGRRDLADLV EAGMDVNIFR KEFEF            655
//

If you have problems or comments...

PBIL Back to PBIL home page