(data stored in ACNUC16935 zone)

EMBL: BN001307.PE360

BN001307.PE360       Location/Qualifiers
FT   CDS             complement(join(994869..995286,995362..996294,
FT                   996357..996358))
FT                   /locus_tag="ANIA_01517"
FT                   /old_locus_tag="AN1517.4"
FT                   /product="nucleic acid-binding protein (AFU_orthologue;
FT                   AFUA_8G05260)"
FT                   /note="transcript_id=CADANIAT00008145"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008145"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008145"
FT                   /db_xref="GOA:C8VMQ1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMQ1"
FT                   /protein_id="CBF85030.1"
FT                   /translation="MYTLRRAACRLLASPSPITRSRLTALPHTHLPVVVRRPITQSRRS
FT                   LGDAKSPLGSKDAPAASTATNSDTTTATATADNALDLSPPVENYAEAVEKDVMKGDLKN
FT                   ELELSSGTTGAATARAVSTKETKQEDGGTCKNLNLKSSDSTRNTSGVPTAPEYEAGAEK
FT                   VREGRPSGTIIANTAPTGATSGVPRASSNAPGAEKAQTLNQGLAAKLSLSESLTKSTTV
FT                   DEQDPDLDFDISQIREAAAQEAWAAAEKKQMTHGEKLDMLRRLQYEPKQTVFIGNLFYD
FT                   VTAEDLKKQMAKYGVVEGVNIIYDSRGISKGYGYVQFSSNAAARRAIDAMHMRIFEGRR
FT                   VTLYYAQTNITNSFKNKKPTNTLYIGNVPFEMTDRDLNDLVKDLDGLTDVRVTVDRQSG
FT                   ALRGYIHAEFLDIQSAMVAHEKLAQRRPYGRRLKIDYSKTKSAQGGFPVAV"
     MYTLRRAACR LLASPSPITR SRLTALPHTH LPVVVRRPIT QSRRSLGDAK SPLGSKDAPA        60
     ASTATNSDTT TATATADNAL DLSPPVENYA EAVEKDVMKG DLKNELELSS GTTGAATARA       120
     VSTKETKQED GGTCKNLNLK SSDSTRNTSG VPTAPEYEAG AEKVREGRPS GTIIANTAPT       180
     GATSGVPRAS SNAPGAEKAQ TLNQGLAAKL SLSESLTKST TVDEQDPDLD FDISQIREAA       240
     AQEAWAAAEK KQMTHGEKLD MLRRLQYEPK QTVFIGNLFY DVTAEDLKKQ MAKYGVVEGV       300
     NIIYDSRGIS KGYGYVQFSS NAAARRAIDA MHMRIFEGRR VTLYYAQTNI TNSFKNKKPT       360
     NTLYIGNVPF EMTDRDLNDL VKDLDGLTDV RVTVDRQSGA LRGYIHAEFL DIQSAMVAHE       420
     KLAQRRPYGR RLKIDYSKTK SAQGGFPVAV                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page