(data stored in ACNUC16935 zone)

EMBL: BN001307.PE362

BN001307.PE362       Location/Qualifiers
FT   CDS             join(1002190..1002431,1002501..1003600,1003654..1003898,
FT                   1003954..1005426)
FT                   /locus_tag="ANIA_01519"
FT                   /old_locus_tag="AN1519.4"
FT                   /product="RNA interference and gene silencing protein
FT                   (Qde2), putative (AFU_orthologue; AFUA_8G05280)"
FT                   /note="transcript_id=CADANIAT00008147"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008147"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008147"
FT                   /db_xref="GOA:Q5BD61"
FT                   /db_xref="InterPro:IPR003100"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014811"
FT                   /db_xref="InterPro:IPR032472"
FT                   /db_xref="InterPro:IPR032474"
FT                   /db_xref="InterPro:IPR036085"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD61"
FT                   /protein_id="CBF85033.1"
FT                   /translation="MSSAGGSPQRGSRGRGNDRGRGRGLFHGDRGRGRGGGRGLFNDLP
FT                   HRPAPGDPGRGGSRGRAGRGGRGGGGGLDQGPPIYLPPDGAPQPNVKVTQTENSQAAAL
FT                   VKKEKTAGYPERPGYGTQGHPIQLFANYLELKSSGKSLFRYHINIDGGGRKPSSRKAKQ
FT                   IICLLLEDHFSPFRHSIVTDYRSNLISHLEILDHEQPSVKYNVTYRSEKEDEPRDTSET
FT                   YRITCKFTGRLDPADLLNYLTSSNAASMLQEKAEILQALNIVLGHHPKSTGSIASVGTN
FT                   KHYAIHDNAAEKFDLGAGLEALRGYFVSVRAATARLLVNIQVKYVACYQDGPLYQVIRE
FT                   FQCANGRNVYALKRFLGRLRVEVTHIKRKNKRGEYIPRIKTITNLATPQDGTQDGNKCK
FT                   DAPKVKFIGAGPNDVSFFLDDPEQGKGSKKAGPKPSGTYITVAEFFKEYYRIQVDPDMP
FT                   VVNVGSIAKPSYLPVEVCDVLSGQPAKTKLSSNQTRQMLNFAVRSPAQNAHSIVTKGTQ
FT                   ILGLRDPTAATLVDFGIQTNPNLITVPGRVLAPPTVYYKDEKSKDKEIAPMSGSWNMKS
FT                   IRFSTSSNLQSWACILITAGPKQHFQSPDDLEDCLYRFTKKLREVGVNANPPVFKVRVQ
FT                   VTKENAETVIDAEIRKILHQHRPKLILTILPFNDTALYNCIKRACDVRHGVRNINVLAE
FT                   QFCKRNEQYFANVGLKFNLKLGGVNQVVRPSQLGIIGEGKTMLIGIDVTHPSPGSAKGA
FT                   PSVAAMVASVDSSLGQWPAEIRIQKEARKEMVDALDSMLKAHLRRWAANHKAAYPENII
FT                   VYRDGVSEGQYDHVTDEELPLLKNACKNIYPAPDTARNLPRFSIIIVGKRHHTRFYPTL
FT                   QEDADRFNNPVNGTVVDRGITEARNWDFFLQAHTALKGTARPAHYYTVWDEIFLRQKVI
FT                   PPAKNAADMLEAMTHHMCYLFGRATKAVSICPPAYYADLVCTRARCYLSSAFEPSTPSG
FT                   SVIGAEDSTVKVANDDVLIHPNVRDTMFYI"
     MSSAGGSPQR GSRGRGNDRG RGRGLFHGDR GRGRGGGRGL FNDLPHRPAP GDPGRGGSRG        60
     RAGRGGRGGG GGLDQGPPIY LPPDGAPQPN VKVTQTENSQ AAALVKKEKT AGYPERPGYG       120
     TQGHPIQLFA NYLELKSSGK SLFRYHINID GGGRKPSSRK AKQIICLLLE DHFSPFRHSI       180
     VTDYRSNLIS HLEILDHEQP SVKYNVTYRS EKEDEPRDTS ETYRITCKFT GRLDPADLLN       240
     YLTSSNAASM LQEKAEILQA LNIVLGHHPK STGSIASVGT NKHYAIHDNA AEKFDLGAGL       300
     EALRGYFVSV RAATARLLVN IQVKYVACYQ DGPLYQVIRE FQCANGRNVY ALKRFLGRLR       360
     VEVTHIKRKN KRGEYIPRIK TITNLATPQD GTQDGNKCKD APKVKFIGAG PNDVSFFLDD       420
     PEQGKGSKKA GPKPSGTYIT VAEFFKEYYR IQVDPDMPVV NVGSIAKPSY LPVEVCDVLS       480
     GQPAKTKLSS NQTRQMLNFA VRSPAQNAHS IVTKGTQILG LRDPTAATLV DFGIQTNPNL       540
     ITVPGRVLAP PTVYYKDEKS KDKEIAPMSG SWNMKSIRFS TSSNLQSWAC ILITAGPKQH       600
     FQSPDDLEDC LYRFTKKLRE VGVNANPPVF KVRVQVTKEN AETVIDAEIR KILHQHRPKL       660
     ILTILPFNDT ALYNCIKRAC DVRHGVRNIN VLAEQFCKRN EQYFANVGLK FNLKLGGVNQ       720
     VVRPSQLGII GEGKTMLIGI DVTHPSPGSA KGAPSVAAMV ASVDSSLGQW PAEIRIQKEA       780
     RKEMVDALDS MLKAHLRRWA ANHKAAYPEN IIVYRDGVSE GQYDHVTDEE LPLLKNACKN       840
     IYPAPDTARN LPRFSIIIVG KRHHTRFYPT LQEDADRFNN PVNGTVVDRG ITEARNWDFF       900
     LQAHTALKGT ARPAHYYTVW DEIFLRQKVI PPAKNAADML EAMTHHMCYL FGRATKAVSI       960
     CPPAYYADLV CTRARCYLSS AFEPSTPSGS VIGAEDSTVK VANDDVLIHP NVRDTMFYI       1019
//

If you have problems or comments...

PBIL Back to PBIL home page