(data stored in ACNUC16935 zone)

EMBL: BN001307.PE363

BN001307.PE363       Location/Qualifiers
FT   CDS             complement(join(1006220..1007530,1007601..1007906))
FT                   /locus_tag="ANIA_01520"
FT                   /old_locus_tag="AN1520.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008148"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008148"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008148"
FT                   /db_xref="GOA:Q5BD60"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD60"
FT                   /protein_id="CBF85035.1"
FT                   /translation="MSLKDVYQKFLASPNSASLASDVSLIYITSTTEINGADRVIKHLS
FT                   RQQELKINSQTVLDTVQGSNALCLDIETSLQFLTGGGAYLPNLDETFLFDRVAKFPTIH
FT                   IVRFNANNEIQSIRIYWDQASLLKQVEVIGNRSRNWPVRDADKQTRLIRFASESAPADN
FT                   GPPPAARPEPSSTGKDEAHEAPEAREGSPGKKHIKDPYAAESLFELLSPCKDRGEPVHR
FT                   PRAPASAQPPPRDYKELFVGDEGNDDAPETPSRARAIAPKVGAGKHFAPSRIFEPEEVE
FT                   PSPVVPKLGAGRHFAPSRIFGDDNETASREKPEQIAYRAHPKRFEHFELGGDNSSREIK
FT                   PTTSRPGSRHVKNWDFEDFSTPPKAKRGPRGEEVRHFGWSDDEPEQDTPPARPRVVQPR
FT                   RDAETHFQIADGEEQGNKRIIRSYGNKGLGLYKDTLYAEAEDLEAEGSAKQQASKERPL
FT                   SVVQNGPNRKKDFESHWDDPEATVSHENKKPTGDRVKAAKALESSWHFDKSPEPSKESR
FT                   PPQRRVLKNVNQRSWGFEDEE"
     MSLKDVYQKF LASPNSASLA SDVSLIYITS TTEINGADRV IKHLSRQQEL KINSQTVLDT        60
     VQGSNALCLD IETSLQFLTG GGAYLPNLDE TFLFDRVAKF PTIHIVRFNA NNEIQSIRIY       120
     WDQASLLKQV EVIGNRSRNW PVRDADKQTR LIRFASESAP ADNGPPPAAR PEPSSTGKDE       180
     AHEAPEAREG SPGKKHIKDP YAAESLFELL SPCKDRGEPV HRPRAPASAQ PPPRDYKELF       240
     VGDEGNDDAP ETPSRARAIA PKVGAGKHFA PSRIFEPEEV EPSPVVPKLG AGRHFAPSRI       300
     FGDDNETASR EKPEQIAYRA HPKRFEHFEL GGDNSSREIK PTTSRPGSRH VKNWDFEDFS       360
     TPPKAKRGPR GEEVRHFGWS DDEPEQDTPP ARPRVVQPRR DAETHFQIAD GEEQGNKRII       420
     RSYGNKGLGL YKDTLYAEAE DLEAEGSAKQ QASKERPLSV VQNGPNRKKD FESHWDDPEA       480
     TVSHENKKPT GDRVKAAKAL ESSWHFDKSP EPSKESRPPQ RRVLKNVNQR SWGFEDEE         538
//

If you have problems or comments...

PBIL Back to PBIL home page