(data stored in ACNUC16935 zone)

EMBL: BN001307.PE364

BN001307.PE364       Location/Qualifiers
FT   CDS             complement(join(1008887..1008896,1008959..1009128,
FT                   1009189..1009269,1009319..1009567))
FT                   /locus_tag="ANIA_01521"
FT                   /old_locus_tag="AN1521.4"
FT                   /product="RNA polymerase II subunit 7 (AFU_orthologue;
FT                   AFUA_8G05300)"
FT                   /note="transcript_id=CADANIAT00008149"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008149"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008149"
FT                   /db_xref="GOA:Q5BD59"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD59"
FT                   /protein_id="CBF85037.1"
FT                   /translation="MFFLKEETKVITLHPSYFGPNVREYLINRLNEEEEGRCTGDHFVI
FT                   CVMDMVDIGEGRVLPGNGQAEYTIKYRAIIWKPFRGETVDALVTSVKPTGIFTLAGPLS
FT                   VFIARKNIPSDIRWEPNTVPPQYTDHADQVIEKGTSLRLKILGVKPDVAAINAIGTIKE
FT                   DYLGPL"
     MFFLKEETKV ITLHPSYFGP NVREYLINRL NEEEEGRCTG DHFVICVMDM VDIGEGRVLP        60
     GNGQAEYTIK YRAIIWKPFR GETVDALVTS VKPTGIFTLA GPLSVFIARK NIPSDIRWEP       120
     NTVPPQYTDH ADQVIEKGTS LRLKILGVKP DVAAINAIGT IKEDYLGPL                   169
//

If you have problems or comments...

PBIL Back to PBIL home page