(data stored in ACNUC16935 zone)

EMBL: BN001307.PE365

BN001307.PE365       Location/Qualifiers
FT   CDS             join(1010338..1010370,1010509..1010568,1010632..1011084)
FT                   /locus_tag="ANIA_01522"
FT                   /old_locus_tag="AN1522.4"
FT                   /product="DUF962 domain protein (AFU_orthologue;
FT                   AFUA_8G05310)"
FT                   /note="transcript_id=CADANIAT00008150"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008150"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008150"
FT                   /db_xref="GOA:Q5BD58"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD58"
FT                   /protein_id="CBF85039.1"
FT                   /translation="MALNLEKQLLFVNVAIHITCVPILLFTGIAMASNSPPLIKLPEVL
FT                   QFEDLPPNIGTIAALFYAIFYVLLEPVAGTLIAPLLLGAAALGNRLIATYGMTVNYWFG
FT                   GIHVVSWLLQFVGHGAFEGRAPALLDNLVQALLLAPLFVWMEILFFFGYRPELRARYEA
FT                   SVKKEIAAFKEKRNKALK"
     MALNLEKQLL FVNVAIHITC VPILLFTGIA MASNSPPLIK LPEVLQFEDL PPNIGTIAAL        60
     FYAIFYVLLE PVAGTLIAPL LLGAAALGNR LIATYGMTVN YWFGGIHVVS WLLQFVGHGA       120
     FEGRAPALLD NLVQALLLAP LFVWMEILFF FGYRPELRAR YEASVKKEIA AFKEKRNKAL       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page