(data stored in ACNUC16935 zone)

EMBL: BN001307.PE369

BN001307.PE369       Location/Qualifiers
FT   CDS             join(1017727..1017776,1017837..1017870,1017922..1018288,
FT                   1018348..1018509,1018577..1018764)
FT                   /locus_tag="ANIA_01526"
FT                   /old_locus_tag="AN1526.4"
FT                   /product="DUF850 domain protein (AFU_orthologue;
FT                   AFUA_8G05350)"
FT                   /note="transcript_id=CADANIAT00008154"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008154"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008154"
FT                   /db_xref="GOA:Q5BD54"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD54"
FT                   /protein_id="CBF85046.1"
FT                   /translation="MALQGVEQTILRDPALFYWILIPISVVMILTGMLRHYATILMNSP
FT                   PKPPATLAESRERLSLFRAVNLRNHAPAVLSKEAFEMRKNYLVTGFQTGAFLKDPNSRG
FT                   QPPANPMSDPAAMEGMMGMMKGNMMMMIPQTLIMSWINAFFSGFVILKLPFPLTIRFKS
FT                   MLQSGVMTRDLDVRWVSSLSWYFLNLFGLQSVFGFILGSDNAANHMAQQMGPMGPAAGA
FT                   NPFQPGQDPHKMYLNEAENLEVFEHFSILDGIEDRVLRKYGAAQ"
     MALQGVEQTI LRDPALFYWI LIPISVVMIL TGMLRHYATI LMNSPPKPPA TLAESRERLS        60
     LFRAVNLRNH APAVLSKEAF EMRKNYLVTG FQTGAFLKDP NSRGQPPANP MSDPAAMEGM       120
     MGMMKGNMMM MIPQTLIMSW INAFFSGFVI LKLPFPLTIR FKSMLQSGVM TRDLDVRWVS       180
     SLSWYFLNLF GLQSVFGFIL GSDNAANHMA QQMGPMGPAA GANPFQPGQD PHKMYLNEAE       240
     NLEVFEHFSI LDGIEDRVLR KYGAAQ                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page