(data stored in ACNUC16935 zone)

EMBL: BN001307.PE37

BN001307.PE37        Location/Qualifiers
FT   CDS             complement(join(99793..102406,102752..102813))
FT                   /locus_tag="ANIA_09025"
FT                   /old_locus_tag="AN9025.4"
FT                   /product="Putative transcription factor with C2H2 and
FT                   Zn(2)-Cys(6) DNA binding domain (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007828"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007828"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007828"
FT                   /db_xref="GOA:Q5ARQ5"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036864"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ5"
FT                   /protein_id="CBF84438.1"
FT                   /translation="MEKIELRAGREIRSHVKLPERMHSCQVCDKTYQTRGSLTRHLRNH
FT                   SVNDSQHVCPTCGVAFSRRDLLRRHVRIHRLAQNNLNTTTTSNDLATPAPRRRCHTACQ
FT                   PCREARVKCDGGNPCSQCIATQTECLLGSRTGRVSRVVEKERRQEQYSHSDDGGSAGED
FT                   DKEDGDQEQDFSRVRVETSITAAPAMLHSPVSNVDAPIIPFLGSEDPLPDMDNIDHLAE
FT                   MDFSWTDSLPCTTTSWPWLHESLLLQGNPLLNWTNDSIYALDTGDMVPDSCPGIIPLDT
FT                   AQQLPVISPTKTVTSMSARDDAESGSAPPSEPGKPETRLQGPDMPEFQGQAALQQDQIV
FT                   EELVAYAEKRIVTPGSKLSRSLFWQSMSIRIAEAFRIDPCDSPGSESTLNRLMQIYKEN
FT                   FSPLWPLLSGKEFDSSELHPLLFLTVVSIGCMYGTSQECNFGNKLHERVRRCLAASLIG
FT                   LEDAEGDILWLGRARLLTQVAALYFGQRRAFSYAQHVGAITLAQARRMDLFSTVGRPGM
FT                   TGELSLEQQTVLWQNAEARKRLAFGILRADVFTSVLLNTRPLLSAEEIYLDLPASDEIW
FT                   MNLDTIPLEQLASRLKDESSRALGLPFCDLVRVASDRGEALLNMNPRGYELLIFGLQEY
FT                   VWRFSHDRSMFPRLIGQSDHTVAQKENLPSSPNGLSISASLQTDQLGRTYRRMNDLRND
FT                   RCRITQTLQRWEQSFTSTRTTQSFGQDRTSVMSSLLLLYISYLRLCVPLADLHSAAYIL
FT                   MDNKPLEPKKLQTLQEWAKGTGAVEAIKHVCQIWSLLSQERFRTGTDKAKYNLLSFSGL
FT                   HHAAVVIWTFAGVHSEPVAEVAELPGWRDMAPISIQRDQTRSLLRAVVSLYKHLIPRGW
FT                   YSFAAVAESLAAQPFPDSSR"
     MEKIELRAGR EIRSHVKLPE RMHSCQVCDK TYQTRGSLTR HLRNHSVNDS QHVCPTCGVA        60
     FSRRDLLRRH VRIHRLAQNN LNTTTTSNDL ATPAPRRRCH TACQPCREAR VKCDGGNPCS       120
     QCIATQTECL LGSRTGRVSR VVEKERRQEQ YSHSDDGGSA GEDDKEDGDQ EQDFSRVRVE       180
     TSITAAPAML HSPVSNVDAP IIPFLGSEDP LPDMDNIDHL AEMDFSWTDS LPCTTTSWPW       240
     LHESLLLQGN PLLNWTNDSI YALDTGDMVP DSCPGIIPLD TAQQLPVISP TKTVTSMSAR       300
     DDAESGSAPP SEPGKPETRL QGPDMPEFQG QAALQQDQIV EELVAYAEKR IVTPGSKLSR       360
     SLFWQSMSIR IAEAFRIDPC DSPGSESTLN RLMQIYKENF SPLWPLLSGK EFDSSELHPL       420
     LFLTVVSIGC MYGTSQECNF GNKLHERVRR CLAASLIGLE DAEGDILWLG RARLLTQVAA       480
     LYFGQRRAFS YAQHVGAITL AQARRMDLFS TVGRPGMTGE LSLEQQTVLW QNAEARKRLA       540
     FGILRADVFT SVLLNTRPLL SAEEIYLDLP ASDEIWMNLD TIPLEQLASR LKDESSRALG       600
     LPFCDLVRVA SDRGEALLNM NPRGYELLIF GLQEYVWRFS HDRSMFPRLI GQSDHTVAQK       660
     ENLPSSPNGL SISASLQTDQ LGRTYRRMND LRNDRCRITQ TLQRWEQSFT STRTTQSFGQ       720
     DRTSVMSSLL LLYISYLRLC VPLADLHSAA YILMDNKPLE PKKLQTLQEW AKGTGAVEAI       780
     KHVCQIWSLL SQERFRTGTD KAKYNLLSFS GLHHAAVVIW TFAGVHSEPV AEVAELPGWR       840
     DMAPISIQRD QTRSLLRAVV SLYKHLIPRG WYSFAAVAES LAAQPFPDSS R                891
//

If you have problems or comments...

PBIL Back to PBIL home page