(data stored in ACNUC16935 zone)

EMBL: BN001307.PE370

BN001307.PE370       Location/Qualifiers
FT   CDS             complement(join(1019000..1019086,1019141..1019776))
FT                   /locus_tag="ANIA_01527"
FT                   /old_locus_tag="AN1527.4"
FT                   /product="FAS1 domain-containing protein AN1527 Precursor
FT                   [Source:UniProtKB/Swiss-Prot;Acc:Q5BD53]"
FT                   /note="transcript_id=CADANIAT00008155"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008155"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008155"
FT                   /db_xref="GOA:Q5BD53"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="InterPro:IPR040200"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5BD53"
FT                   /protein_id="CBF85048.1"
FT                   /translation="MRQLSTTALVLFLFFYCSISTAWSLPYFAYRKRIPEPLLNKPRSR
FT                   HARSIEDLDGLKEWLSNQQPLRGAVMAPPSEDNKRTVTVKGGANNEPTISDVLPKTRGI
FT                   NIYASLTRQFETVERRLKDQTQNVTVLAPRNSAIQDLPHKPWENPDDYEKFGEMNAYEG
FT                   DKGQDRAKRNLERFVSAHVVAQSPWREGEEAETLGGDKLTWRKDGDRIYIEPERIRVES
FT                   IAEQVSNGEVWVIDGVIN"
     MRQLSTTALV LFLFFYCSIS TAWSLPYFAY RKRIPEPLLN KPRSRHARSI EDLDGLKEWL        60
     SNQQPLRGAV MAPPSEDNKR TVTVKGGANN EPTISDVLPK TRGINIYASL TRQFETVERR       120
     LKDQTQNVTV LAPRNSAIQD LPHKPWENPD DYEKFGEMNA YEGDKGQDRA KRNLERFVSA       180
     HVVAQSPWRE GEEAETLGGD KLTWRKDGDR IYIEPERIRV ESIAEQVSNG EVWVIDGVIN       240
//

If you have problems or comments...

PBIL Back to PBIL home page