(data stored in ACNUC16935 zone)

EMBL: BN001307.PE373

BN001307.PE373       Location/Qualifiers
FT   CDS             complement(join(1026514..1027352,1027428..1027653))
FT                   /locus_tag="ANIA_01531"
FT                   /old_locus_tag="AN1531.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008157"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008157"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008157"
FT                   /db_xref="GOA:Q5BD49"
FT                   /db_xref="InterPro:IPR031398"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD49"
FT                   /protein_id="CBF85052.1"
FT                   /translation="MPSIVRFGRPKKSSKPETENANSTPHVSATPNSFRAPRISLPHVD
FT                   AELNMAQHNGLFEVDPPERQKGTEAAETIMDSTSPPPSYISNASANPMNGDATGAEWSS
FT                   AVGHAATGKSGRVIHNLQEDIARLTRECSVYRSRAEETQRMNEAFKTQVQNMTDRLRNL
FT                   EHSNEMNLHSLSRKEKKIEELRAELKGERDRRQQADDEKARFRQLMDEAQDGFHQKCAE
FT                   LQEIAHHAQTQYDVLVKSGQRERADQQRRLKNIRDEFIALREAHNQTNSQLSQLDAIMA
FT                   QKDQEIERGRANFDALFKEYEAYKRAHDEEVRDLIKQTRQGEAKFNATLASLKETESQM
FT                   KWVVQVKREVKDAE"
     MPSIVRFGRP KKSSKPETEN ANSTPHVSAT PNSFRAPRIS LPHVDAELNM AQHNGLFEVD        60
     PPERQKGTEA AETIMDSTSP PPSYISNASA NPMNGDATGA EWSSAVGHAA TGKSGRVIHN       120
     LQEDIARLTR ECSVYRSRAE ETQRMNEAFK TQVQNMTDRL RNLEHSNEMN LHSLSRKEKK       180
     IEELRAELKG ERDRRQQADD EKARFRQLMD EAQDGFHQKC AELQEIAHHA QTQYDVLVKS       240
     GQRERADQQR RLKNIRDEFI ALREAHNQTN SQLSQLDAIM AQKDQEIERG RANFDALFKE       300
     YEAYKRAHDE EVRDLIKQTR QGEAKFNATL ASLKETESQM KWVVQVKREV KDAE             354
//

If you have problems or comments...

PBIL Back to PBIL home page