(data stored in ACNUC16935 zone)

EMBL: BN001307.PE374

BN001307.PE374       Location/Qualifiers
FT   CDS             complement(join(1028839..1029282,1029330..1029470))
FT                   /locus_tag="ANIA_01532"
FT                   /old_locus_tag="AN1532.4"
FT                   /product="extracellular matrix protein, putative
FT                   (AFU_orthologue; AFUA_8G05410)"
FT                   /note="transcript_id=CADANIAT00008158"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008158"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008158"
FT                   /db_xref="GOA:C8VMR4"
FT                   /db_xref="InterPro:IPR018466"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMR4"
FT                   /protein_id="CBF85054.1"
FT                   /translation="MHPLRPLLATWACLAQVSFAAVSFTKWPTTIHTGKPATVYWKGDS
FT                   DTPVTITLRQGPAGNLRTLKVLTHDAQGGSFTWVPDESLAPGSDYALQIEQDGSINYSG
FT                   LVTLVDQSGKKPQPSASKHTPVSSPLGGARTSVQKGNNGYIPTLNSSSARVNMTSGKST
FT                   AHKTSNDGVTFRYISAEMILAAMAAVVYFAA"
     MHPLRPLLAT WACLAQVSFA AVSFTKWPTT IHTGKPATVY WKGDSDTPVT ITLRQGPAGN        60
     LRTLKVLTHD AQGGSFTWVP DESLAPGSDY ALQIEQDGSI NYSGLVTLVD QSGKKPQPSA       120
     SKHTPVSSPL GGARTSVQKG NNGYIPTLNS SSARVNMTSG KSTAHKTSND GVTFRYISAE       180
     MILAAMAAVV YFAA                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page