(data stored in ACNUC16935 zone)

EMBL: BN001307.PE377

BN001307.PE377       Location/Qualifiers
FT   CDS             join(1033617..1033647,1033712..1034160,1034243..1034465,
FT                   1034524..1034549)
FT                   /locus_tag="ANIA_01534"
FT                   /old_locus_tag="AN1534.4"
FT                   /product="ATP synthase subunit 4, mitochondrial precursor
FT                   (Broad)"
FT                   /note="transcript_id=CADANIAT00008161"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008161"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008161"
FT                   /db_xref="GOA:Q5BD46"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="InterPro:IPR013837"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD46"
FT                   /protein_id="CBF85060.1"
FT                   /translation="MASRLAKSAIGVTRLRPTLASRNVAAVTLSATRAASNVPTEDPKQ
FT                   KAQSILDSLPGNSLVSKTAILSATAGLSIAAISNELYVMNEETVAAFCLLSVFTAVAKY
FT                   GGPAYKEWAEAQVQKHKDILNAARADHTNAVKQRMENVKELSGVVDLTKQLFEVSKETA
FT                   KLEAQAYELEQRTALAAEAKQVLDSWVRYEGQVKQRQQRELAETVIGKIQKELQNPKTL
FT                   QQILNQSVADVERIMSSKAQ"
     MASRLAKSAI GVTRLRPTLA SRNVAAVTLS ATRAASNVPT EDPKQKAQSI LDSLPGNSLV        60
     SKTAILSATA GLSIAAISNE LYVMNEETVA AFCLLSVFTA VAKYGGPAYK EWAEAQVQKH       120
     KDILNAARAD HTNAVKQRME NVKELSGVVD LTKQLFEVSK ETAKLEAQAY ELEQRTALAA       180
     EAKQVLDSWV RYEGQVKQRQ QRELAETVIG KIQKELQNPK TLQQILNQSV ADVERIMSSK       240
     AQ                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page