(data stored in ACNUC16935 zone)

EMBL: BN001307.PE378

BN001307.PE378       Location/Qualifiers
FT   CDS             join(1035484..1036035,1036089..1036128,1036199..1036292,
FT                   1036359..1036665,1036814..1036878,1037225..1037342)
FT                   /locus_tag="ANIA_01535"
FT                   /old_locus_tag="AN1535.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008162"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008162"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008162"
FT                   /db_xref="GOA:Q5BD45"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD45"
FT                   /protein_id="CBF85062.1"
FT                   /translation="MPLRDILHKKDRLNNTSDQYATDTLDAANSVPEIRFIRSDTTTQE
FT                   IIIPPNHDVDHEDRLASPRPSSSSSHRRTLNPFHRSRTPPDPQDPGSPRERRFSGFLRR
FT                   GSSSSSVNLPPDLPQIAADAGDEQEREAQWEKRATVLAQQSPRYGSPSHSPAPSMGLGS
FT                   ENVRPRSRSSSHSRINDPQGDVNILEAIRLHEAGELEQSTSMFAQLADTTGANNALSQV
FT                   LYGLALRHGWGCRPDPEKAVVYLSAAASNSASIEAQALEAGLKKGGAAKGELVLAIFEL
FT                   GNCFRNGWGVKKDPAAARQYFETAANLGDTDAMNEVAWCYLEGFGGKKDKFMAAKYYRL
FT                   AESKGNKIVGNSCKSAHLQPLSKTGTRHLGAPAQPYHAPQPYHAPGSRTDG"
     MPLRDILHKK DRLNNTSDQY ATDTLDAANS VPEIRFIRSD TTTQEIIIPP NHDVDHEDRL        60
     ASPRPSSSSS HRRTLNPFHR SRTPPDPQDP GSPRERRFSG FLRRGSSSSS VNLPPDLPQI       120
     AADAGDEQER EAQWEKRATV LAQQSPRYGS PSHSPAPSMG LGSENVRPRS RSSSHSRIND       180
     PQGDVNILEA IRLHEAGELE QSTSMFAQLA DTTGANNALS QVLYGLALRH GWGCRPDPEK       240
     AVVYLSAAAS NSASIEAQAL EAGLKKGGAA KGELVLAIFE LGNCFRNGWG VKKDPAAARQ       300
     YFETAANLGD TDAMNEVAWC YLEGFGGKKD KFMAAKYYRL AESKGNKIVG NSCKSAHLQP       360
     LSKTGTRHLG APAQPYHAPQ PYHAPGSRTD G                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page