(data stored in ACNUC16935 zone)

EMBL: BN001307.PE38

BN001307.PE38        Location/Qualifiers
FT   CDS             complement(join(107206..107450,107501..107937,
FT                   108031..108194))
FT                   /locus_tag="ANIA_09024"
FT                   /old_locus_tag="AN9024.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007829"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007829"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007829"
FT                   /db_xref="GOA:Q5ARQ6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARQ6"
FT                   /protein_id="CBF84439.1"
FT                   /translation="MNIYATGFSRQKFILCTTRGTTEFRNHRDPLMAPFDKIKPYSELK
FT                   LNSDGEISERYGFPHLGHPSQKYSLSWKTDQAGGGWLSLGNYFGFSTVFIKKREVVKPR
FT                   TGFPKLQRAFHENLVGLIEAFQDGADIYLAYNYHGFAVSLSQVCSTPGIRLAESDLASI
FT                   CRSVLKGLEYIHETLLVAHGNVDSNNTLLCHDGAVKIANIGDSMMDVGHQRSFALDREN
FT                   VGSLLVQLSIAHMTELPPRNQGSNLGAYINLSKYAEHFGFLVLDGSSRKKPRLVGFGPT
FT                   "
     MNIYATGFSR QKFILCTTRG TTEFRNHRDP LMAPFDKIKP YSELKLNSDG EISERYGFPH        60
     LGHPSQKYSL SWKTDQAGGG WLSLGNYFGF STVFIKKREV VKPRTGFPKL QRAFHENLVG       120
     LIEAFQDGAD IYLAYNYHGF AVSLSQVCST PGIRLAESDL ASICRSVLKG LEYIHETLLV       180
     AHGNVDSNNT LLCHDGAVKI ANIGDSMMDV GHQRSFALDR ENVGSLLVQL SIAHMTELPP       240
     RNQGSNLGAY INLSKYAEHF GFLVLDGSSR KKPRLVGFGP T                           281
//

If you have problems or comments...

PBIL Back to PBIL home page