(data stored in ACNUC16935 zone)

EMBL: BN001307.PE380

BN001307.PE380       Location/Qualifiers
FT   CDS             complement(join(1047357..1047916,1048010..1048065,
FT                   1048115..1048856,1048908..1048953))
FT                   /locus_tag="ANIA_01537"
FT                   /old_locus_tag="AN1537.4"
FT                   /product="CCCH zinc finger protein (AFU_orthologue;
FT                   AFUA_8G05480)"
FT                   /note="transcript_id=CADANIAT00008164"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008164"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008164"
FT                   /db_xref="GOA:C8VMX4"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMX4"
FT                   /protein_id="CBF85065.1"
FT                   /translation="MSEDQDLMARISQLAGQINRFKNGNTPVQSAHNEMHSNSHVSRHT
FT                   SYRGRPGWAPYRGRPYGRGRGAAPHRHRTLILNNSATPASKSSTPPDGMAIDTDENSRS
FT                   ATPNAWVTKHARHMQLINSAVYDKEAQKRVKALEETRKAKAQKKAQIEQAKVLQFAHGA
FT                   GRQFSSSSNPQVSAAGESHGEYQITLNDIPFRVSRGGGKLIRVSSATPVLSALIERAGL
FT                   QIVDDPNTANNTPKRVKVAGVTFVRSKNGNLHRLGAVTSKRVPSAVKKKDELCQRFTTT
FT                   GTCYKGPSCPYIHDPNKVAICKDFLQTGKCSAGNSCDLSHEPSPHRSPACVHFLRGRCS
FT                   NPECRYAHVRVTPGAPVCRAFATLGYCDKGETCEERHVHECPDYANTGVCKKKHCRLPH
FT                   VDRAGQIRKNAGPKEGEGDDESDASSEEEEFDEIGSDDVDSDYLSDEGELIEGTETGEV
FT                   SKQQDFIRL"
     MSEDQDLMAR ISQLAGQINR FKNGNTPVQS AHNEMHSNSH VSRHTSYRGR PGWAPYRGRP        60
     YGRGRGAAPH RHRTLILNNS ATPASKSSTP PDGMAIDTDE NSRSATPNAW VTKHARHMQL       120
     INSAVYDKEA QKRVKALEET RKAKAQKKAQ IEQAKVLQFA HGAGRQFSSS SNPQVSAAGE       180
     SHGEYQITLN DIPFRVSRGG GKLIRVSSAT PVLSALIERA GLQIVDDPNT ANNTPKRVKV       240
     AGVTFVRSKN GNLHRLGAVT SKRVPSAVKK KDELCQRFTT TGTCYKGPSC PYIHDPNKVA       300
     ICKDFLQTGK CSAGNSCDLS HEPSPHRSPA CVHFLRGRCS NPECRYAHVR VTPGAPVCRA       360
     FATLGYCDKG ETCEERHVHE CPDYANTGVC KKKHCRLPHV DRAGQIRKNA GPKEGEGDDE       420
     SDASSEEEEF DEIGSDDVDS DYLSDEGELI EGTETGEVSK QQDFIRL                     467
//

If you have problems or comments...

PBIL Back to PBIL home page