(data stored in ACNUC16935 zone)

EMBL: BN001307.PE381

BN001307.PE381       Location/Qualifiers
FT   CDS             complement(join(1049310..1049690,1049742..1049938,
FT                   1049988..1050252,1050350..1050580))
FT                   /locus_tag="ANIA_01538"
FT                   /old_locus_tag="AN1538.4"
FT                   /product="transcription initiation factor iif, beta subunit
FT                   (AFU_orthologue; AFUA_8G05490)"
FT                   /note="transcript_id=CADANIAT00008165"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008165"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008165"
FT                   /db_xref="GOA:Q5BD42"
FT                   /db_xref="InterPro:IPR003196"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040450"
FT                   /db_xref="InterPro:IPR040504"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD42"
FT                   /protein_id="CBF85067.1"
FT                   /translation="MFSHIKQEHDASSPYIKPDPETKDTVLADIDDEDVYEDDGDLDFT
FT                   NADQSLWLSRIPRSLWEHWSKLDDDDEIQIGTVSLRLTESEENRDIPKDYILSRQTLNS
FT                   ENLLHMTQNTYLFTEKDIPGYENRMVTFGEARSALYESMKRDARRKERKKKWEPYIRKT
FT                   IPKRTALVGQVKEEFNCLPVENEEFRILSEKKALEALKPRREVKYVDKMPAKLLQQRHA
FT                   LPGEQGAFVQATKPAKLKAQENKTTRMPQNELLDLIYQCFREYRYWPFKTLKARLRQPE
FT                   AYLKQTLEMIAHLVKSGDFAMTWELKPEARESNYSNAMDVKQEAAPGLDYNFDEGSETD
FT                   AMASGVDNDDTQFENVV"
     MFSHIKQEHD ASSPYIKPDP ETKDTVLADI DDEDVYEDDG DLDFTNADQS LWLSRIPRSL        60
     WEHWSKLDDD DEIQIGTVSL RLTESEENRD IPKDYILSRQ TLNSENLLHM TQNTYLFTEK       120
     DIPGYENRMV TFGEARSALY ESMKRDARRK ERKKKWEPYI RKTIPKRTAL VGQVKEEFNC       180
     LPVENEEFRI LSEKKALEAL KPRREVKYVD KMPAKLLQQR HALPGEQGAF VQATKPAKLK       240
     AQENKTTRMP QNELLDLIYQ CFREYRYWPF KTLKARLRQP EAYLKQTLEM IAHLVKSGDF       300
     AMTWELKPEA RESNYSNAMD VKQEAAPGLD YNFDEGSETD AMASGVDNDD TQFENVV          357
//

If you have problems or comments...

PBIL Back to PBIL home page