(data stored in ACNUC16935 zone)

EMBL: BN001307.PE383

BN001307.PE383       Location/Qualifiers
FT   CDS             complement(join(1053210..1054034,1054087..1054157,
FT                   1054219..1054240))
FT                   /locus_tag="ANIA_01540"
FT                   /old_locus_tag="AN1540.4"
FT                   /product="integral membrane protein (AFU_orthologue;
FT                   AFUA_8G05510)"
FT                   /note="transcript_id=CADANIAT00008167"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008167"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008167"
FT                   /db_xref="GOA:Q5BD40"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD40"
FT                   /protein_id="CBF85071.1"
FT                   /translation="MHIELVLWVVIGGNGSHQADLSEKTMQNFFKIFLANQFTYFALSP
FT                   AIKISIVCFYRRVFAIQTFQWTSFAINTLIALWGAAIFIACGLQCRPLNAYWDHTVVGN
FT                   CFDSNKYIIVNQVFNVLMDFVILALPIPMIWNLQRSWQDKLALNGVFAVGGVVCLASIY
FT                   RIVVLFWINPADITYTVYEATLWTHIEPSIGLICACLPIIRGLFPQFKLSAGRVDNATY
FT                   YGRTYQTTTSTSHTPLSPSLKSPLSEKFFAHQLEEIRSNKAPSLPATPHDNSEFYQGSL
FT                   SPFAIEVRTDIDVENSGQSVRSYK"
     MHIELVLWVV IGGNGSHQAD LSEKTMQNFF KIFLANQFTY FALSPAIKIS IVCFYRRVFA        60
     IQTFQWTSFA INTLIALWGA AIFIACGLQC RPLNAYWDHT VVGNCFDSNK YIIVNQVFNV       120
     LMDFVILALP IPMIWNLQRS WQDKLALNGV FAVGGVVCLA SIYRIVVLFW INPADITYTV       180
     YEATLWTHIE PSIGLICACL PIIRGLFPQF KLSAGRVDNA TYYGRTYQTT TSTSHTPLSP       240
     SLKSPLSEKF FAHQLEEIRS NKAPSLPATP HDNSEFYQGS LSPFAIEVRT DIDVENSGQS       300
     VRSYK                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page