(data stored in ACNUC16935 zone)

EMBL: BN001307.PE384

BN001307.PE384       Location/Qualifiers
FT   CDS             join(1056809..1057266,1057315..1057708,1057759..1058216,
FT                   1058298..1058442)
FT                   /locus_tag="ANIA_01541"
FT                   /old_locus_tag="AN1541.4"
FT                   /product="aldehyde dehydrogenase family protein
FT                   (AFU_orthologue; AFUA_8G05520)"
FT                   /note="transcript_id=CADANIAT00008168"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008168"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008168"
FT                   /db_xref="GOA:Q5BD39"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD39"
FT                   /protein_id="CBF85073.1"
FT                   /translation="MTTPTPSVIPLIINGKEELASSVFDVISPYTNKACWAAASASPQD
FT                   AIRAVEAAQAAFPAWSQTKPTVRRDILLKAADILESRLEKCAEFMRTEMGADAGASQFF
FT                   VVPLAIRMLREVASRITSICGTVPVVEAEGQSAIIYKEPMGVILGIVPWNAPYVFGVRS
FT                   AACALAAGNTTILKSSELTPCCYWALTRAFHDAGLPDGCLNLVSCRPQDAAEVVNAMIE
FT                   HPAVMKINFTGSTAVGRKIARACGQNLKPCLMELGGKNSSIVCADADIETAVKSVIAGA
FT                   YLNSGQICMATDRILVHSSIAPTFVEALKSALQSMSDPSSEPPTLVNVASKARVQRLIE
FT                   SALEAGAHIIHGSVTADSDAANSDSGVRMPPVLLGGVKEDMAVWQDEAFASLAACMTFD
FT                   TEEEAVRIANSSGYGLSAAVFTQDLRKGLAIARKIQSGAVHINSMTIHDEPVLPHGGVK
FT                   NSGWGRFNASQGLEEFLVTKSVTWMD"
     MTTPTPSVIP LIINGKEELA SSVFDVISPY TNKACWAAAS ASPQDAIRAV EAAQAAFPAW        60
     SQTKPTVRRD ILLKAADILE SRLEKCAEFM RTEMGADAGA SQFFVVPLAI RMLREVASRI       120
     TSICGTVPVV EAEGQSAIIY KEPMGVILGI VPWNAPYVFG VRSAACALAA GNTTILKSSE       180
     LTPCCYWALT RAFHDAGLPD GCLNLVSCRP QDAAEVVNAM IEHPAVMKIN FTGSTAVGRK       240
     IARACGQNLK PCLMELGGKN SSIVCADADI ETAVKSVIAG AYLNSGQICM ATDRILVHSS       300
     IAPTFVEALK SALQSMSDPS SEPPTLVNVA SKARVQRLIE SALEAGAHII HGSVTADSDA       360
     ANSDSGVRMP PVLLGGVKED MAVWQDEAFA SLAACMTFDT EEEAVRIANS SGYGLSAAVF       420
     TQDLRKGLAI ARKIQSGAVH INSMTIHDEP VLPHGGVKNS GWGRFNASQG LEEFLVTKSV       480
     TWMD                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page