(data stored in ACNUC16935 zone)

EMBL: BN001307.PE386

BN001307.PE386       Location/Qualifiers
FT   CDS             join(1063457..1063481,1063536..1063675)
FT                   /locus_tag="ANIA_11306"
FT                   /old_locus_tag="AN11306.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008170"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008170"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008170"
FT                   /db_xref="GOA:C8VMY0"
FT                   /db_xref="UniProtKB/TrEMBL:C8VMY0"
FT                   /protein_id="CBF85076.1"
FT                   /translation="MIDEGTRRDSPSTDDTKTGRCLSMVQGFERREASTELEFTMTQSN
FT                   DGERAELLS"
     MIDEGTRRDS PSTDDTKTGR CLSMVQGFER REASTELEFT MTQSNDGERA ELLS              54
//

If you have problems or comments...

PBIL Back to PBIL home page