(data stored in ACNUC16935 zone)

EMBL: BN001307.PE388

BN001307.PE388       Location/Qualifiers
FT   CDS             complement(1066921..1067961)
FT                   /locus_tag="ANIA_01544"
FT                   /old_locus_tag="AN1544.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00008172"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00008172"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00008172"
FT                   /db_xref="GOA:Q5BD36"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BD36"
FT                   /protein_id="CBF85080.1"
FT                   /translation="MSDHQKRGSSEDSNTPTKQRPDRNDGDPAQSDQDTQSLASRIQKS
FT                   ASGLARNAFFSSTPSGDTAHLLSDSGKAAPSSSSSALAAAEQYKDTTGPSSSASRDHNV
FT                   HVPAETFRSPGATHSGGFELPRLTEDEFQSTYGGNLSDTIDPLDETKGKGRAINSVPGS
FT                   GLTSSIYHDGTTAPPTLNPSDGDAVVAILNDQTFDPEFPPSANEPPEYVETELSPLQLT
FT                   PEEMQMIESFRRQLPPDSQSTTDTQQKRQLNSFSLVPDIGSFLDTVPAASATDATSLRD
FT                   TVLANLPGAAEWMSVEEEYHDEVWGYLRPTLEAAAKEIESKKDSGITEDGPAVRRLKMI
FT                   LKHMQH"
     MSDHQKRGSS EDSNTPTKQR PDRNDGDPAQ SDQDTQSLAS RIQKSASGLA RNAFFSSTPS        60
     GDTAHLLSDS GKAAPSSSSS ALAAAEQYKD TTGPSSSASR DHNVHVPAET FRSPGATHSG       120
     GFELPRLTED EFQSTYGGNL SDTIDPLDET KGKGRAINSV PGSGLTSSIY HDGTTAPPTL       180
     NPSDGDAVVA ILNDQTFDPE FPPSANEPPE YVETELSPLQ LTPEEMQMIE SFRRQLPPDS       240
     QSTTDTQQKR QLNSFSLVPD IGSFLDTVPA ASATDATSLR DTVLANLPGA AEWMSVEEEY       300
     HDEVWGYLRP TLEAAAKEIE SKKDSGITED GPAVRRLKMI LKHMQH                      346
//

If you have problems or comments...

PBIL Back to PBIL home page